Os03t0586900-01

Locus

Os03g0586900

Description

DNA helicase, putative domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

RBP-59

Oryzabase Gene Name Synonym(s)

RNA-binding RBP-59

Transcript Evidence

AK099721 (DDBJ, Best hit)

Protein Evidence

B8AL83 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: hydrolase activity (GO:0016787)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ATPase, AAA+ type, core (IPR003593)

DNA helicase, putative (IPR004483)

Helicase/UvrB domain (IPR006935)

DEAD-like helicase (IPR014001)

Full-length cDNA

J013088F16 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0586900-01)

RiceXPro (AK099721)

Others

Oryzabase (22092)

KEGG (Os03t0586900-01)

Transcript

2448 bp

>Os03t0586900-01 DNA helicase, putative domain containing protein.
GTGGACGAGACGAGTGAGAGGAGGAGAGCGGCCATGGCGGGGCGGAGTGGCGGCGGCGGC
GGCGGGAGCTCCGGGAAGAGCGGGACGGGGAGGATGGTGTCGCTGCAGGAGTTCGTCTCG
TCCATGGCGCCTCTCATAGACCTGGAGAAGGCGGCGGAGATATCGGCGGAGTCGGCGACG
AGCTCGAAGACCCTCGAGAGGAGGGGTTGCGTCATGGCCAACCTCAAGTGCACCGACGCC
CAGACGGGGCTGATGGGGAAGACGCTCCTGGAGTTCCAACCCAACAAGGGCGACGTGCTT
CCACCTCACAAGTTTGGAACACACGATGTGGTTGCTCTGAAGCCAAATAAGGCAGATGCT
GGATCTGCTGCTCTTGGGCAAGGTGTAGTTTATCGCTTGAAGGATTCTTCCATTACTGTT
GCCTTTGATGACATTCCTGAAGATGGATTAAATAGCCCTCTCCGCCTTGAAAAGCTTGCA
AATGAGGTGACATACCGCAGGATGAAGGATGCACTAGTTCAACTTAGTAAGGGCATTCAA
ACAGGCCCTTCAGCAAACCTTATTCCTGTTTTGTTTGGAGAAAACCCACCTATGAGTTCC
AAGGATGTTGCGAAGTTCAGTCCATTTAACAAGAATTTGGATGAGTCACAGAAAGATGCT
ATCTCGAAGGCCCTCAGGTCAAGGGATGTTTTCTTGCTTCATGGACCTCCTGGCACTGGG
AAGACAACAACTATCATTGAGATAATATTGCAGGAGGTGAAACGTGGATCAAAGATTCTT
GCTTGTGCTGCTTCTAACATCGCCGTGGATAACATTGTTGAGCGACTCTCCCGATATAGA
ACCAAATTGGTGAGGTTAGGCCATCCTGCTCGATTACTACCCCAAGTGTTGGACAGTGCT
CTTGACGCACAGGTATTGCGAGCAGATAACAGCAGCTTAGCAGGAGATATTCGCAAAGAA
ATGAAGGTGCTTAATAGCAAATTGCTGAAAGCTAAGGATAAGAATACAAAAAGGGACATC
AGGAAAGAGCTCAGAACCCTTGCCAAAGAAGAGAGAAAACGACAACAGCTTGCTGTTGCT
GATGTGATAAAAAATGCAGATGTTGTACTGTCGACTTTGACTGGTGCATCTTCCAAAAAG
CTAGATGGTATTACATTTGATTTGGTCATTATTGATGAAGCTGCTCAGGCACTTGAGATG
GCATGTTGGATAGCCTTATTGAAGGGTCCAAGATGTGTGCTTGCTGGAGACCATCTTCAA
CTTCCTCCGACTATCCAAAGTGCTGAGGCTGAGAAGAAGGGGATGGGAAAGACACTCTTT
GAACGCCTTACTGAAGCTTATGGAGATCAAATTACATCCATGCTCACTATCCAGTACAGA
ATGCATGAGCTCATAATGAATTGGTCATCTAAAGAACTTTATAATAACAAGATCAAAGCT
CATTCTAGTGTTGCTGATCATATGCTCTATGACATTGAAGAAGTGAAAAGATCTTCTTCC
ACAGAGCCGACTATCATACTAATTGACACTACTGGGTGTGACATGGAAGAAGTAAAAGAT
GAGGAGGAGAGCACTATGAATGAGGGTGAGGCTGCAGTATCCATTGCTCATGCCAAGCTG
CTTGTTGAGAGTGGTGTCCGTGCATCTGATATTGGAATAATTACACCTTATGCTGCACAG
GTAACCTGTCTGAAGATGATGAGAAACAAAGATACTAAACTGAAGGACTTGGAGATATCG
ACAGTTGATGGGTTCCAGGGTAGGGAGAAAGAAGCCATCATCATTTCAATGGTCAGATCC
AACTCAAAGAAAGAGGTCGGATTCTTAAGTGATCATAGACGAATGAATGTTGCTGTAACA
CGAGCCAGAAGGCAGTGCTGCCTAGTGTGCGATGTAGAGACCGTAAGCAACGACAAATTC
TTGAAACGCTTGGTTGAGTACTTTGAGGAGAACGGGGAGTACTTGAGTGCATCAGAATAC
CAGAGCTGATGACTTGGGGTGTTAACCCTTAACCGTGATAGCCCGTGCTTATCGCAAAGA
TAGTGAAGAGATATATCCAAACGATGCTTGTGATAGGAACATCGTGCACTTCAAACTGGT
GCAATATGGCCAATGGAGATACTGTCATTCGACTTTTATAGATTGGAAACAGATCGCTGT
GAGACTGAACAGATAATTAGCTCAGGAGTGGATCAATTTCGTCTTGACTGGCCCTGTTCT
GGTCTCTTCTTCTGTGGCTTATGGAAATGAAACCTCAGTTATGTGTTTTTATATGTCCGT
TCTTTCAGCTGATGTACAATGATAGAAGACTAATTTTATTCATCCATGTGCAAATCTACC
ATAGTTTTTTGCATGGAGTTTTGAAACTTGGGTCCACAAAAATAGTAATAATAGGATAGG
AGGTTGACTGTACTGAACTTCGCATGATAATTAATCTGTATCTCATCC

CDS

1956 bp

>Os03t0586900-01 DNA helicase, putative domain containing protein.
ATGGCGGGGCGGAGTGGCGGCGGCGGCGGCGGGAGCTCCGGGAAGAGCGGGACGGGGAGG
ATGGTGTCGCTGCAGGAGTTCGTCTCGTCCATGGCGCCTCTCATAGACCTGGAGAAGGCG
GCGGAGATATCGGCGGAGTCGGCGACGAGCTCGAAGACCCTCGAGAGGAGGGGTTGCGTC
ATGGCCAACCTCAAGTGCACCGACGCCCAGACGGGGCTGATGGGGAAGACGCTCCTGGAG
TTCCAACCCAACAAGGGCGACGTGCTTCCACCTCACAAGTTTGGAACACACGATGTGGTT
GCTCTGAAGCCAAATAAGGCAGATGCTGGATCTGCTGCTCTTGGGCAAGGTGTAGTTTAT
CGCTTGAAGGATTCTTCCATTACTGTTGCCTTTGATGACATTCCTGAAGATGGATTAAAT
AGCCCTCTCCGCCTTGAAAAGCTTGCAAATGAGGTGACATACCGCAGGATGAAGGATGCA
CTAGTTCAACTTAGTAAGGGCATTCAAACAGGCCCTTCAGCAAACCTTATTCCTGTTTTG
TTTGGAGAAAACCCACCTATGAGTTCCAAGGATGTTGCGAAGTTCAGTCCATTTAACAAG
AATTTGGATGAGTCACAGAAAGATGCTATCTCGAAGGCCCTCAGGTCAAGGGATGTTTTC
TTGCTTCATGGACCTCCTGGCACTGGGAAGACAACAACTATCATTGAGATAATATTGCAG
GAGGTGAAACGTGGATCAAAGATTCTTGCTTGTGCTGCTTCTAACATCGCCGTGGATAAC
ATTGTTGAGCGACTCTCCCGATATAGAACCAAATTGGTGAGGTTAGGCCATCCTGCTCGA
TTACTACCCCAAGTGTTGGACAGTGCTCTTGACGCACAGGTATTGCGAGCAGATAACAGC
AGCTTAGCAGGAGATATTCGCAAAGAAATGAAGGTGCTTAATAGCAAATTGCTGAAAGCT
AAGGATAAGAATACAAAAAGGGACATCAGGAAAGAGCTCAGAACCCTTGCCAAAGAAGAG
AGAAAACGACAACAGCTTGCTGTTGCTGATGTGATAAAAAATGCAGATGTTGTACTGTCG
ACTTTGACTGGTGCATCTTCCAAAAAGCTAGATGGTATTACATTTGATTTGGTCATTATT
GATGAAGCTGCTCAGGCACTTGAGATGGCATGTTGGATAGCCTTATTGAAGGGTCCAAGA
TGTGTGCTTGCTGGAGACCATCTTCAACTTCCTCCGACTATCCAAAGTGCTGAGGCTGAG
AAGAAGGGGATGGGAAAGACACTCTTTGAACGCCTTACTGAAGCTTATGGAGATCAAATT
ACATCCATGCTCACTATCCAGTACAGAATGCATGAGCTCATAATGAATTGGTCATCTAAA
GAACTTTATAATAACAAGATCAAAGCTCATTCTAGTGTTGCTGATCATATGCTCTATGAC
ATTGAAGAAGTGAAAAGATCTTCTTCCACAGAGCCGACTATCATACTAATTGACACTACT
GGGTGTGACATGGAAGAAGTAAAAGATGAGGAGGAGAGCACTATGAATGAGGGTGAGGCT
GCAGTATCCATTGCTCATGCCAAGCTGCTTGTTGAGAGTGGTGTCCGTGCATCTGATATT
GGAATAATTACACCTTATGCTGCACAGGTAACCTGTCTGAAGATGATGAGAAACAAAGAT
ACTAAACTGAAGGACTTGGAGATATCGACAGTTGATGGGTTCCAGGGTAGGGAGAAAGAA
GCCATCATCATTTCAATGGTCAGATCCAACTCAAAGAAAGAGGTCGGATTCTTAAGTGAT
CATAGACGAATGAATGTTGCTGTAACACGAGCCAGAAGGCAGTGCTGCCTAGTGTGCGAT
GTAGAGACCGTAAGCAACGACAAATTCTTGAAACGCTTGGTTGAGTACTTTGAGGAGAAC
GGGGAGTACTTGAGTGCATCAGAATACCAGAGCTGA

Protein

652 aa

>Os03t0586900-01 DNA helicase, putative domain containing protein.
MAGRSGGGGGGSSGKSGTGRMVSLQEFVSSMAPLIDLEKAAEISAESATSSKTLERRGCV
MANLKCTDAQTGLMGKTLLEFQPNKGDVLPPHKFGTHDVVALKPNKADAGSAALGQGVVY
RLKDSSITVAFDDIPEDGLNSPLRLEKLANEVTYRRMKDALVQLSKGIQTGPSANLIPVL
FGENPPMSSKDVAKFSPFNKNLDESQKDAISKALRSRDVFLLHGPPGTGKTTTIIEIILQ
EVKRGSKILACAASNIAVDNIVERLSRYRTKLVRLGHPARLLPQVLDSALDAQVLRADNS
SLAGDIRKEMKVLNSKLLKAKDKNTKRDIRKELRTLAKEERKRQQLAVADVIKNADVVLS
TLTGASSKKLDGITFDLVIIDEAAQALEMACWIALLKGPRCVLAGDHLQLPPTIQSAEAE
KKGMGKTLFERLTEAYGDQITSMLTIQYRMHELIMNWSSKELYNNKIKAHSSVADHMLYD
IEEVKRSSSTEPTIILIDTTGCDMEEVKDEEESTMNEGEAAVSIAHAKLLVESGVRASDI
GIITPYAAQVTCLKMMRNKDTKLKDLEISTVDGFQGREKEAIIISMVRSNSKKEVGFLSD
HRRMNVAVTRARRQCCLVCDVETVSNDKFLKRLVEYFEENGEYLSASEYQS*

5'UTR

chr03:21673719..21673751 (+ strand) : 33 bp

CDS

chr03:21673752..21673868 (+ strand) : 117 bp

chr03:21673976..21674068 (+ strand) : 93 bp

chr03:21674184..21674252 (+ strand) : 69 bp

chr03:21674650..21674739 (+ strand) : 90 bp

chr03:21674825..21674908 (+ strand) : 84 bp

chr03:21675185..21675349 (+ strand) : 165 bp

chr03:21676092..21676279 (+ strand) : 188 bp

chr03:21676460..21676532 (+ strand) : 73 bp

chr03:21676863..21676916 (+ strand) : 54 bp

chr03:21677116..21677373 (+ strand) : 258 bp

chr03:21677988..21678194 (+ strand) : 207 bp

chr03:21678390..21678493 (+ strand) : 104 bp

chr03:21678906..21679050 (+ strand) : 145 bp

chr03:21679205..21679339 (+ strand) : 135 bp

chr03:21679707..21679880 (+ strand) : 174 bp

3'UTR

chr03:21679881..21680339 (+ strand) : 459 bp

FASTA

>Os03t0586900-01 class=Sequence position=chr03:21673719..21680339 (+ strand)
GTGGACGAGA CGAGTGAGAG GAGGAGAGCG GCCATGGCGG GGCGGAGTGG CGGCGGCGGC GGCGGGAGCT CCGGGAAGAG
CGGGACGGGG AGGATGGTGT CGCTGCAGGA GTTCGTCTCG TCCATGGCGC CTCTCATAGA CCTGGAGAAG GTTCCGTACT
CCGATCCCCC ATCGCTTTTC TTTCGCTGTT TGGTTCGGAA GGTGGAACGG ATGGTAGTGG TGGTGGGTGG TGACGCGTCT
GTGGTGTGGT TGCGCAGGCG GCGGAGATAT CGGCGGAGTC GGCGACGAGC TCGAAGACCC TCGAGAGGAG GGGTTGCGTC
ATGGCCAACC TCAAGTGCAC CGACGCCCAG GTTGATTTGC TTCCATTTTG CTGCTTGCTT GCTTGCCCAT CGGTGCCAAT
GTGTCATCGA GGCGTGGTGC TAATCTTGTT CTGGCCTTGT TGGACCTGCT TGGTGCGTAG AGTAGACGGG GCTGATGGGG
AAGACGCTCC TGGAGTTCCA ACCCAACAAG GGCGACGTGC TTCCACCTCA CAAGGTGAGG TTACCTTTGC CCTCCTGTCG
TATTGTTGTT ATTGCTCGCT GTGATAAAAT TCTGGTTAGG AATTTATTTG TGGTATGTGA GAGCGGTTTG TTTCAGAACA
ATTGTCGCTT CAGGTATTGC CGTCGAAACT CACACTTGCA GTATTTCTGC CATTTGTTTA GTAATTGTGA ACAAGTAATG
TTGTTGTTAA CTGATAGTTT CAGTGAAATA TTAGATTCGT TTGTAAAGTT CATTATGAAT TGCATCACGT GTATTATTGA
TTTTGTTGAG ATTGGCAGGA GTTGATACAT GAAAAGCTCA TGCATGTTTC TTAATTTACC GGACACTGAT TCAAAGAAAT
TTGTATTTTA CTTCACCATT GCTAATGCCC ACTTATGTTT TTCTTCTCTA GTTTGGAACA CACGATGTGG TTGCTCTGAA
GCCAAATAAG GCAGATGCTG GATCTGCTGC TCTTGGGCAA GGTGTAGTTT ATCGCTTGAA GGTACCTAAC TATCATCTAA
GGGCTGTTGA CTATTTAAAG TCTTTGCTTC TGAATTAGGA GAAATGACTG TAATTTGAAC AAACAGGATT CTTCCATTAC
TGTTGCCTTT GATGACATTC CTGAAGATGG ATTAAATAGC CCTCTCCGCC TTGAAAAGCT TGCAAATGAG GTATATTTTC
CATGCTGTTT TCATTACTAT TTGCAAATGA CATTCCATTA CTGTTTTCTT CTCTACTATA TTTTCCATGC TCTCTCTTAC
AACTTTCTGA TTAGAAATTT TATAGCCTCC AAGTAACCAT AATAGTATAA TTGTATCATA ATTCCTCTTT GCTTTTTTTT
TATCTCCATG TATGTATTTC TATATATCTT CATTATTGCC CCTTGTCCTC CAGCATTGCC TTACAATTCA TTGGACCCTA
AATTTTGCAT CTTAATGCTC TTCTAGGTGA CATACCGCAG GATGAAGGAT GCACTAGTTC AACTTAGTAA GGGCATTCAA
ACAGGCCCTT CAGCAAACCT TATTCCTGTT TTGTTTGGAG AAAACCCACC TATGAGTTCC AAGGATGTTG CGAAGTTCAG
TCCATTTAAC AAGAATTTGG ATGAGTCACA GGTTACAATT TGATTTATTT TTTTCAACTG CTTTTTTTTG GCTTGTTGCA
TAATTATGTT TCAGTTAAGT TCTTATCTAA ATAAGGAGAA GAGAAGCCAT AAGTACTTGG GGCCTGGAGA AATTTATCAG
AACAGTATGA TCTACAATAG AATTTTCCAG TGCAATCACT TTGTTCTGCT GATACTATTT CAAGTATCAG TAGAATTTGT
ATTTTTAACT TATTAAGTAC CAGAGGAAGA TCTGAAATTT ATTGAATGGC AGACACTCAT GATTTTAAGA AAATAAAAGA
ACATATGGAA CTAGGCAAAT AACGCTAACA CCAGCACCTG CAGTTTCAGA CTGTGGACAT TCCATCACTT TTGGCATTAC
AACTTACAAC CAAATGTGTC AACACCGTCA TCGATTACAT ATAATTCTTG CACCTGCTAA TACTGGCTTT GGAAGACCTC
ATCCTGAGTA GTAGCATATA TTTGCAATAC TTCTGTTAAT GGTGTTGCTT TTGCTTCGGT GAACTCCACA GCTAATTATG
CTGGCACTGG TGTTTGGCCT CCACATTTTT TATTTTCTTT GCTAGAAATT GATTGTTTAA TAAAAATAAA AAAATTACAA
TTGATGCCTT TTGTCTTTAC CATGTATATC TACTTGTTAT GTTCTTTTTT GTATCGCCTT CAAATACCAG TTTCAATATG
TATTCAAATG AAATAAATTT CCTTTTTGTG GGGCCCATAT CTTTGTTCTG CAGAAAGATG CTATCTCGAA GGCCCTCAGG
TCAAGGGATG TTTTCTTGCT TCATGGACCT CCTGGCACTG GGAAGACAAC AACTATCATT GAGATAATAT TGCAGGAGGT
GAAACGTGGA TCAAAGATTC TTGCTTGTGC TGCTTCTAAC ATCGCCGTGG ATAACATTGT TGAGCGACTC TCCCGATATA
GGTTGCTAAC AAAATTTTGA AATACCTTTT TAACTCGAAC TTTCTATTCC CCCATCTATC TTGGTAATGT TGACCATTTA
CCTCATTCAA CCAATAATAA CTGAGAAAAT TCTCCCTATC CTGTCAAAAT AAAAGATGTG ATATTGGTTA ATGTGACATG
TTGTTATTGA CATTTTTCTA GAACCAAATT GGTGAGGTTA GGCCATCCTG CTCGATTACT ACCCCAAGTG TTGGACAGTG
CTCTTGACGC ACAGGTATAG CTTACTCTGA GTGCTTCCTT TTCTCCTCTA CTGAGGATTA TTAGGATAAA TATTCATGAA
GGTTATGTTC CATAATTATT TCATCAGAGT TGCTTTGTCT CTTTCAATTT TCAACTGTTA TATTTATTCA AATACCTTGT
TAAAGTGTAC CCGCCTACGC CTTATGTGAC ATCTGTAACA TCTGCATGAC ATTCTCTTTA TGCCCAAGTT AAAATGGGAT
AGATTTTCTT ATGAATTACA GTTCCACCTG TATTATCTAT GATCCATTCA TGCATTCACA TAACTTAACT GTACTTAATC
TGCTTACTAT TTCTAATGAA CCAGGTATTG CGAGCAGATA ACAGCAGCTT AGCAGGAGAT ATTCGCAAAG AAATGAAGGT
AATCATTTAC TACATAATTC TTAGGTTCCT ATTATTAAAT GGCAAGACCC TGCTTTACAT GGCATATTAT TTTGGCATTT
CAGGAACCAT CTAATTAGAA GCTGTCATGT TTAGATGATA GTAATGAAAC TGCAATTTCA ATAATGTTTT CCATTGTAGT
TAAATGTTTC TTGATTTGTT CTCTTTTCAT CTTTTAGGTG CTTAATAGCA AATTGCTGAA AGCTAAGGAT AAGAATACAA
AAAGGGACAT CAGGAAAGAG CTCAGAACCC TTGCCAAAGA AGAGAGAAAA CGACAACAGC TTGCTGTTGC TGATGTGATA
AAAAATGCAG ATGTTGTACT GTCGACTTTG ACTGGTGCAT CTTCCAAAAA GCTAGATGGT ATTACATTTG ATTTGGTCAT
TATTGATGAA GCTGCTCAGG CACTTGAGAT GGCATGTTGG ATAGCCTTAT TGAAGGTTAA TACTAACTTA TGACTAGTTT
TTTTTTTCAT GTTGCTGCAC GTTTTGAGAA TGATGATTGC TGTAAACAGT CATCAAAGGT TCTCGTATTA TTTATGCTTT
TTTGAGTAGC ACAATAAAGA TAGCATGTAC TGTTTCACAA ACTCCCACCT TTAACTTTAA GCTTAAAATA TGTCTTAACC
AAGCCAGCAG TTGAGCATGA TCACACGGGT TCAATTTTAA AAGTGCATGG TATAATGAGA ACGAGATGCT GCATTAGGTG
TCCATTTTAG AGCAAAAGGA AGGATTATGA GAGAAGTTGG GAAAACTAAA TGATTTCCTT GGAAGATAGC TAAACTTAAT
TTCAATAGGT GGTTACACGT ACTTGAATTC ATTCTATCAA TCTTGTATGG ATGTATGTAA ACTCTAACAA GTTCTCATGA
CCCCTGTGGG GCTCCTTCAC ACTCCACAAG TTGGCTTCTC TGATTATGCC AGTGAACAAT TTCATCACCT ATTTGATTGC
TTGTGTTTGT CATGATTCAG CATGCACAGC GCGTAGGTTA AATGGTCATC ATACTGTACT TATTGAGATC TGTCATAGGG
CTCCTCAGTT CTTTTGTTTT TGTATGCAGG GTCCAAGATG TGTGCTTGCT GGAGACCATC TTCAACTTCC TCCGACTATC
CAAAGTGCTG AGGCTGAGAA GAAGGGGATG GGAAAGACAC TCTTTGAACG CCTTACTGAA GCTTATGGAG ATCAAATTAC
ATCCATGCTC ACTATCCAGT ACAGAATGCA TGAGCTCATA ATGAATTGGT CATCTAAAGA ACTTTATAAT AACAAGGTGC
ACTTCCCATT GGTGTTTTTA CACTAGCCAC CTATTAGTAA CTTGTTTTCA CTAGCCACCT ATTAGTAACT TGTTTTCAGC
CTCTCTCTTT AGTCCATAAC TTTCCTCATG TTGTTATTTC TTTGTTTCTT GTACTTAGAT CAAAGCTCAT AACTTTTCTC
ATGTTGTTAT TTCTTTGTTT CTTGTACTTA GATCAAAGCT CATTCTAGTG TTGCTGATCA TATGCTCTAT GACATTGAAG
AAGTGAAAAG ATCTTCTTCC ACAGAGCCGA CTATCATACT AATTGACACT ACTGGGTTAG TATTCTCCAA TGCTTGGCCT
ATTCAATGTG TTCATTCTTT TAGTCATTTA TGGGTTGAAC TTGAACCTTG GCAATTTTGC TTCCCTCGTT GCTTTCTTTC
CCTCACTCAA TAGTGTTGGC TTCCTCTATA AAAGAGTGTC GGCTTCCTCT ATATTTCCCT CACTCAATAG TGTTGGCTTC
CTCTATAAAA GAGTGTTGGC TTCCTCTATA AAAGATAGGA CTACCGAATT CACTTCAAAG GGTTATCTCA TACTTGAAGA
CAATAATTGG GCAGAAGTAA TACTTCAAAT TTGTAGCCAT CATTTGACTG ATGAATAAAA GATATCTGTT TTTTTAAAAG
AAATGATGTG ATGACCAACA TCAATGTTTG TTAGATACAC TTCTAACAGT CTCAAGTAAT CATTTAGGTG TGACATGGAA
GAAGTAAAAG ATGAGGAGGA GAGCACTATG AATGAGGGTG AGGCTGCAGT ATCCATTGCT CATGCCAAGC TGCTTGTTGA
GAGTGGTGTC CGTGCATCTG ATATTGGAAT AATTACACCT TATGCTGCAC AGGTTTGCTC CTATATGCTC TGAATATTAT
CAAATCAATA TACAGTGATG AGCTTAATAA AACAAAACAA AATAAACGTT TATAGGACTT ATGGGTTGGC TCCTTCATGA
TGTTGAAGTT TATAGGACTG ACTCATTGAA TGGTGTAATC CCGTAGGTAA CCTGTCTGAA GATGATGAGA AACAAAGATA
CTAAACTGAA GGACTTGGAG ATATCGACAG TTGATGGGTT CCAGGGTAGG GAGAAAGAAG CCATCATCAT TTCAATGGTC
AGATCCAACT CAAAGAAAGA GGTAAGCTCC CTTCCATGAT CCTCCTTGGT GAGTGGATAT CCTATGTAAA ATATTCAGCT
TTACAAACAT GAATATTATA CATGGATGAG GATTTGATTG CTGCTGCACA GTTGATCCAT CAAATTAGCA TCTGGGGAGA
CTTCAACTTA TTTTAGAAAA ATGTTTAATA GAATAGAGCG AATCAGTATC GATATGATGT GAACGATCTG TAGATATATG
TGCATGCCAT GCAAAATATC TCATTATTGA CATAAGGACG AAATATCATT TTTAAAATAA AAGGACTGTC TGATTGAACT
ACTGAAATAA GAATTCACAA TTATATTACC TGGATACTAA GGAAACCTTA TCTATTTGCA AATTTCAGGT CGGATTCTTA
AGTGATCATA GACGAATGAA TGTTGCTGTA ACACGAGCCA GAAGGCAGTG CTGCCTAGTG TGCGATGTAG AGACCGTAAG
CAACGACAAA TTCTTGAAAC GCTTGGTTGA GTACTTTGAG GAGAACGGGG AGTACTTGAG TGCATCAGAA TACCAGAGCT
GATGACTTGG GGTGTTAACC CTTAACCGTG ATAGCCCGTG CTTATCGCAA AGATAGTGAA GAGATATATC CAAACGATGC
TTGTGATAGG AACATCGTGC ACTTCAAACT GGTGCAATAT GGCCAATGGA GATACTGTCA TTCGACTTTT ATAGATTGGA
AACAGATCGC TGTGAGACTG AACAGATAAT TAGCTCAGGA GTGGATCAAT TTCGTCTTGA CTGGCCCTGT TCTGGTCTCT
TCTTCTGTGG CTTATGGAAA TGAAACCTCA GTTATGTGTT TTTATATGTC CGTTCTTTCA GCTGATGTAC AATGATAGAA
GACTAATTTT ATTCATCCAT GTGCAAATCT ACCATAGTTT TTTGCATGGA GTTTTGAAAC TTGGGTCCAC AAAAATAGTA
ATAATAGGAT AGGAGGTTGA CTGTACTGAA CTTCGCATGA TAATTAATCT GTATCTCATC C