Os03t0607200-01

Locus

Os03g0607200

Description

Gibberellin regulated protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK070268 (DDBJ, Best hit)

Protein Evidence

C8C4P9 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Gibberellin regulated protein (IPR003854)

Full-length cDNA

J023044E14 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0607200-01)

RiceXPro (AK070268)

Others

KEGG (Os03t0607200-01)

Transcript

772 bp

>Os03t0607200-01 Gibberellin regulated protein family protein.
GCATATTTGCTTTGCTCCCCTTCCACGACTTTAGCCATCTTGGCTTGCAAGGTGAGAAGA
GCAGATCGATCGAGCTGAGAGCTGGTCTCAGGTGTGTGTTGCGTGAGTGTGTTCGAAGAC
GAACGATGAAGACCCGCCGGGCCGCGCTGCTAATGCTTCTCCTCCTGGTGGTGGTGGCGG
CCGCCTCGTGGCCGCAGCCTTGCGACGCTGCTTCAGGGTTCTGCGGGAGCAAGTGCGCGG
TGCGGTGCGGGAGGGGGAGGGGGCGGGGGAGCGGGTGCCTGAGGTCGTGCGGGCTGTGCT
GCGAGGAGTGCAACTGCGTGCCCACGGGGAGTGGGTCGACGCGCGACGAGTGCCCCTGCT
ACCGCGACATGCTCACCGCCGGCCCCAGGAAGAGGCCCAAGTGCCCCTGAATCCTCCCCA
TCCATCTCCATCTCATCGATTACCATCAACTTCATCTCATTTTCTTGTACTTGAAATTAG
CTACTAGTACGTGGTTGTGTATACGTCGCAGGTGTGTATGTATGTATGTATATATATGCG
TATGTTGTCATGCTGCGTAGTTATAGTTAGTAGTCCTACCTACTCCAGTACGTACGTGTT
GATGCCTGTTAATATGGCTGTATGGCTAGCTAAGCTGTGTGCCTGTGTCGATTTGTAAAG
TTGTACTAGTAGGTAGTTGTACTACTTGCAGCGCACGTACTGTTTGTTTGTCTGTTGTTA
AATTTCGTGTTAACTATGAACAGGGGATATGCCGTATGCGCTTTACCTGAGG

CDS

285 bp

>Os03t0607200-01 Gibberellin regulated protein family protein.
ATGAAGACCCGCCGGGCCGCGCTGCTAATGCTTCTCCTCCTGGTGGTGGTGGCGGCCGCC
TCGTGGCCGCAGCCTTGCGACGCTGCTTCAGGGTTCTGCGGGAGCAAGTGCGCGGTGCGG
TGCGGGAGGGGGAGGGGGCGGGGGAGCGGGTGCCTGAGGTCGTGCGGGCTGTGCTGCGAG
GAGTGCAACTGCGTGCCCACGGGGAGTGGGTCGACGCGCGACGAGTGCCCCTGCTACCGC
GACATGCTCACCGCCGGCCCCAGGAAGAGGCCCAAGTGCCCCTGA

Protein

94 aa

>Os03t0607200-01 Gibberellin regulated protein family protein.
MKTRRAALLMLLLLVVVAAASWPQPCDAASGFCGSKCAVRCGRGRGRGSGCLRSCGLCCE
ECNCVPTGSGSTRDECPCYRDMLTAGPRKRPKCP*

5'UTR

chr03:22817650..22817774 (- strand) : 125 bp

CDS

chr03:22817559..22817649 (- strand) : 91 bp

chr03:22817295..22817488 (- strand) : 194 bp

3'UTR

chr03:22816933..22817294 (- strand) : 362 bp

FASTA

>Os03t0607200-01 class=Sequence position=chr03:22816933..22817774 (- strand)
GCATATTTGC TTTGCTCCCC TTCCACGACT TTAGCCATCT TGGCTTGCAA GGTGAGAAGA GCAGATCGAT CGAGCTGAGA
GCTGGTCTCA GGTGTGTGTT GCGTGAGTGT GTTCGAAGAC GAACGATGAA GACCCGCCGG GCCGCGCTGC TAATGCTTCT
CCTCCTGGTG GTGGTGGCGG CCGCCTCGTG GCCGCAGCCT TGCGACGCTG CTTCAGGTAA CCGATCGATT TGTGAGTTTG
CGATGCGTGC GTGGTGCCGT TGCCTACAAA TTGGCGTTTG CTGCAGGGTT CTGCGGGAGC AAGTGCGCGG TGCGGTGCGG
GAGGGGGAGG GGGCGGGGGA GCGGGTGCCT GAGGTCGTGC GGGCTGTGCT GCGAGGAGTG CAACTGCGTG CCCACGGGGA
GTGGGTCGAC GCGCGACGAG TGCCCCTGCT ACCGCGACAT GCTCACCGCC GGCCCCAGGA AGAGGCCCAA GTGCCCCTGA
ATCCTCCCCA TCCATCTCCA TCTCATCGAT TACCATCAAC TTCATCTCAT TTTCTTGTAC TTGAAATTAG CTACTAGTAC
GTGGTTGTGT ATACGTCGCA GGTGTGTATG TATGTATGTA TATATATGCG TATGTTGTCA TGCTGCGTAG TTATAGTTAG
TAGTCCTACC TACTCCAGTA CGTACGTGTT GATGCCTGTT AATATGGCTG TATGGCTAGC TAAGCTGTGT GCCTGTGTCG
ATTTGTAAAG TTGTACTAGT AGGTAGTTGT ACTACTTGCA GCGCACGTAC TGTTTGTTTG TCTGTTGTTA AATTTCGTGT
TAACTATGAA CAGGGGATAT GCCGTATGCG CTTTACCTGA GG

Locus: Os03g0607200

Loading...

Locus: Os03g0607200

Loading...