Os03t0606466-01

Locus

Os03g0606466

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK289268 (DDBJ, Best hit)

Protein Evidence

Q6EUE2 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J100090H24 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0606466-01)

Transcript

2263 bp

>Os03t0606466-01 Conserved hypothetical protein.
accaacttaaatgaaaatcgagggttaggtttttttttcagaatttctaagattttatct
attttgttagagtgctatgtagcagcttgagagcgttttcagagcaccacgtggcggcat
gagagcgtttgtatgaagtttaatagacttttatataataataataataataATAATAAT
AATAATAATAATAATAATAATAATAATAATAGAAAGAATAGAATAGAAATTATGATGTGG
ATCTAATTAGAAAAAAAAAGAATGGGGGAGGAACTGGATTGTGCACATGGAGGCAAACGT
ACCTGCTACGTACGTAGGCACGTGTGGGGCCAGCCAGGAGGGTTGGGCGAAGGGAGTTTA
GTTTTTAAGGATTTTTTTCTGATTTATTAGGGTGTCaatacaactaatctaatctaatgg
tataaattatcgggtccaccgatttaagtgaaaatcaatggtgagattagatattgccac
atggcggtctaggagcgattgtagaagtgccacatagcggcttgagagcgtttgtaggaa
gtttaatagacttttagtatataataatagatagatTCACATGCCCGTACCTCGTCAGGC
CCATACTAGCAATTGAAAATATAACAAAATACGAGGAGGAAAATAGAGTTACTTCTGACG
GGCCGTAACCAAAACTCATCACAGGTGAGGGTCGTCTCTCACAGGGTAGATATTTTAACC
CGTCACGGGTTACTTTTATCTATAACGGATCATAATAAGGAATCGTCACTTTTGTGGAAG
GGGGGAAATAATTTCATGCAACTGTCCATCATAGCTGTATATTACAATTTGAAAAAAAAA
TACAAAAATATTGTCCGCCTAGCTTGCCATCACATTCATTTGAACAGTCATTGACCACTC
ACAAATCACAAAAATCTTTATAATCACACAGCTGAGTATTCCAAACACTTATTCATGGGG
AATAAGAAAATCAACAACATGGACAAATAAGTATCACACAATTTGTATGTATGCCCTGAC
AAACTTCGAGTGGTCCAAGAACAAACTATTTTCTGTTCTCCAAACTTCAGAACAAAGGTG
GGAAGAAGGGAAAACACCTCGATGAGTCAATGGAGATGGAGACAACACTGGTGTGCGCGT
GCCACCTCGCTCCGTGGCGCACTACCTGGGCCGCCTCCTCCTTGACGGTTTTGAGGAACT
CCTTGGACTATGCCAACGTCAACACCTCCATCACCGTAGTCGTCGTTGTTGCCACCACCG
TGCTCGCTACAACCGTAGTCGTTGTAGCAGTCGTCGTACTCATTACAGTTATCGCTAGTC
GCCCCTGCCACTTTGACTGCCGGCAGATCTGGCTGGCATTGGCTCATGTGTGGTCAGATC
TGATGCCTCTGACCTCAGGGAGGCCCCATCTGGCACCCCCGAGGTAGCGGCAACCAGATC
AGATGGGGGCTGGTGCATGGGAAGGGGGTGAAGAGCTAGTCGTCAGTGCTTGATCAATAG
AGGCAGTGGTGGCAGCCTGTGGAGCTTGAGATGGTAGCGTCGGTCGGTGGTGCAAAGTag
gggtgggcattcagtctaactgaaaatttcggcctcggtcttcggtctttcgggtcttta
aaaagtgaagaccgaacttaaacgtaaaaatgtcagtaccgataaattcggtctcagtct
tggtcctgaccgaaattcaacaacattttcatatatgcaaagaaataatggacattttca
acaaaaaatcacaaaaaaaaaatcgtaaacacatatgagtaaagactcttattaggttgc
atgcctagaagaaatagggatgtgaaaattagagtttaatcctattgaatttagtgtact
gtaggttgcatttagatatttttttgttaattcggtctattcagttaaccaaggagacta
accaaattaaccgaacaaaattcggtctttcactgcctaggaccgaattgatgactgaat
ttctcggtctcggtcttttcggtttggtgtttttctgtccacccctaGTGCAAAGGTGTC
CAACGGAGCTCAAGATGGCCAGCGGTAGGTGGAGCTCGACACAATGGTGGCTAATGGACG
CAAAGCCGCTAGCGAGAGAGAGAGGAGGGTACTTGTTGCTGGTTAGAGAGAGAGAGATCC
GTGTCACTCGGCCTCGGTGAAGGCCGGATCCGACGACAAGCGGTCGAGGGGCAGAGTAGG
CAGTGCCTGCGGTCATATCCACATCCCCCGACTTCGTGGGGAC

CDS

348 bp

>Os03t0606466-01 Conserved hypothetical protein.
agtttaatcctattgaatttagtgtactgtaggttgcatttagatatttttttgttaatt
cggtctattcagttaaccaaggagactaaccaaattaaccgaacaaaattcggtctttca
ctgcctaggaccgaattgatgactgaatttctcggtctcggtcttttcggtttggtgttt
ttctgtccacccctaGTGCAAAGGTGTCCAACGGAGCTCAAGATGGCCAGCGGTAGGTGG
AGCTCGACACAATGGTGGCTAATGGACGCAAAGCCGCTAGCGAGAGAGAGAGGAGGGTAC
TTGTTGCTGGTTAGAGAGAGAGAGATCCGTGTCACTCGGCCTCGGTGA

Protein

115 aa

>Os03t0606466-01 Conserved hypothetical protein.
SLILLNLVYCRLHLDIFLLIRSIQLTKETNQINRTKFGLSLPRTELMTEFLGLGLFGLVF
FCPPLVQRCPTELKMASGRWSSTQWWLMDAKPLARERGGYLLLVREREIRVTRPR*

5'UTR

chr03:22757986..22759817 (- strand) : 1832 bp

CDS

chr03:22757638..22757985 (- strand) : 348 bp

3'UTR

chr03:22757555..22757637 (- strand) : 83 bp

FASTA

>Os03t0606466-01 class=Sequence position=chr03:22757555..22759817 (- strand)
accaacttaa atgaaaatcg agggttaggt ttttttttca gaatttctaa gattttatct attttgttag agtgctatgt
agcagcttga gagcgttttc agagcaccac gtggcggcat gagagcgttt gtatgaagtt taatagactt ttatataata
ataataataa taATAATAAT AATAATAATA ATAATAATAA TAATAATAAT AGAAAGAATA GAATAGAAAT TATGATGTGG
ATCTAATTAG AAAAAAAAAG AATGGGGGAG GAACTGGATT GTGCACATGG AGGCAAACGT ACCTGCTACG TACGTAGGCA
CGTGTGGGGC CAGCCAGGAG GGTTGGGCGA AGGGAGTTTA GTTTTTAAGG ATTTTTTTCT GATTTATTAG GGTGTCaata
caactaatct aatctaatgg tataaattat cgggtccacc gatttaagtg aaaatcaatg gtgagattag atattgccac
atggcggtct aggagcgatt gtagaagtgc cacatagcgg cttgagagcg tttgtaggaa gtttaataga cttttagtat
ataataatag atagatTCAC ATGCCCGTAC CTCGTCAGGC CCATACTAGC AATTGAAAAT ATAACAAAAT ACGAGGAGGA
AAATAGAGTT ACTTCTGACG GGCCGTAACC AAAACTCATC ACAGGTGAGG GTCGTCTCTC ACAGGGTAGA TATTTTAACC
CGTCACGGGT TACTTTTATC TATAACGGAT CATAATAAGG AATCGTCACT TTTGTGGAAG GGGGGAAATA ATTTCATGCA
ACTGTCCATC ATAGCTGTAT ATTACAATTT GAAAAAAAAA TACAAAAATA TTGTCCGCCT AGCTTGCCAT CACATTCATT
TGAACAGTCA TTGACCACTC ACAAATCACA AAAATCTTTA TAATCACACA GCTGAGTATT CCAAACACTT ATTCATGGGG
AATAAGAAAA TCAACAACAT GGACAAATAA GTATCACACA ATTTGTATGT ATGCCCTGAC AAACTTCGAG TGGTCCAAGA
ACAAACTATT TTCTGTTCTC CAAACTTCAG AACAAAGGTG GGAAGAAGGG AAAACACCTC GATGAGTCAA TGGAGATGGA
GACAACACTG GTGTGCGCGT GCCACCTCGC TCCGTGGCGC ACTACCTGGG CCGCCTCCTC CTTGACGGTT TTGAGGAACT
CCTTGGACTA TGCCAACGTC AACACCTCCA TCACCGTAGT CGTCGTTGTT GCCACCACCG TGCTCGCTAC AACCGTAGTC
GTTGTAGCAG TCGTCGTACT CATTACAGTT ATCGCTAGTC GCCCCTGCCA CTTTGACTGC CGGCAGATCT GGCTGGCATT
GGCTCATGTG TGGTCAGATC TGATGCCTCT GACCTCAGGG AGGCCCCATC TGGCACCCCC GAGGTAGCGG CAACCAGATC
AGATGGGGGC TGGTGCATGG GAAGGGGGTG AAGAGCTAGT CGTCAGTGCT TGATCAATAG AGGCAGTGGT GGCAGCCTGT
GGAGCTTGAG ATGGTAGCGT CGGTCGGTGG TGCAAAGTag gggtgggcat tcagtctaac tgaaaatttc ggcctcggtc
ttcggtcttt cgggtcttta aaaagtgaag accgaactta aacgtaaaaa tgtcagtacc gataaattcg gtctcagtct
tggtcctgac cgaaattcaa caacattttc atatatgcaa agaaataatg gacattttca acaaaaaatc acaaaaaaaa
aatcgtaaac acatatgagt aaagactctt attaggttgc atgcctagaa gaaataggga tgtgaaaatt agagtttaat
cctattgaat ttagtgtact gtaggttgca tttagatatt tttttgttaa ttcggtctat tcagttaacc aaggagacta
accaaattaa ccgaacaaaa ttcggtcttt cactgcctag gaccgaattg atgactgaat ttctcggtct cggtcttttc
ggtttggtgt ttttctgtcc acccctaGTG CAAAGGTGTC CAACGGAGCT CAAGATGGCC AGCGGTAGGT GGAGCTCGAC
ACAATGGTGG CTAATGGACG CAAAGCCGCT AGCGAGAGAG AGAGGAGGGT ACTTGTTGCT GGTTAGAGAG AGAGAGATCC
GTGTCACTCG GCCTCGGTGA AGGCCGGATC CGACGACAAG CGGTCGAGGG GCAGAGTAGG CAGTGCCTGC GGTCATATCC
ACATCCCCCG ACTTCGTGGG GAC

Locus: Os03g0606466

Loading...

Locus: Os03g0606466

Loading...