Os03t0624600-01

Locus

Os03g0624600

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ONAC006, ONAC6, DLN95, OsDLN95

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 006, NAC domain-containing protein 6, DLN repressor 95, DLN motif protein 95

Transcript Evidence

AK062675 (DDBJ, Best hit)

Protein Evidence

XP_002318549.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

001-105-G11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0624600-01)

RiceXPro (AK062675)

Others

Oryzabase (11458)

KEGG (Os03t0624600-01)

Transcript

1345 bp

>Os03t0624600-01 No apical meristem (NAM) protein domain containing protein.
ATGGACATTAGCTAGCTCAGCTCAGCTCACTGCCACTGCCGCTCTGCCTGCCGGCGATCG
AGGAGAAGACCGGCCGGCGGCGAGCTAGCAGGAGAGGGCTAGTGATggaggaggggttgc
cgccggggttccggttccacccgacggacgaggagctggtgacgtactacctcgcccgca
aggtctccgacttcggcttcgccacccgcgccatcgccgacgtcgacctcaacaagtgcg
agccatgggacctccccagcaaggcaagcatgggggagaaggagtggtacttcttcagca
tgcgcgaccgcaagtacccgacggggatccgcaccaaccgcgccacggactccggctact
ggaagaccaccggcaaggacaaggagatcttccacggcggcgcgctcgccggcatgaaga
agacgctggtgttctaccgcgggagggcgcccaagggcgccaagaccagctgggtgatgc
acgagtacaggctccagtccaagttccccTACAAGCCCGCCAAGGACGAGTGGGTCGTCT
GCCGCGTCTTCAAGAAGCTCCAGTGCCACCTCGCCAAGCCCCGCCCGCCGCACGACGACG
TCGACGGAGACGGCGCCTCGCCGCCGGAGATGGTGGACGCCTCGTCGCTCGGCGAGCTTG
GCGAGCTCGACGTCTCCTCCATCCTCCTCGGCGGCTTCGCGCCGCCGTCGGGCGAGCTCT
GCCATGGCGGCGGCGGCGGAGACGGTTTCGGCGCGCACAGGCTTCATGTCGGCGCGTACA
TGAGCTGGCTGCAGGCGGCGGCGGCGGCCAACCAGGGCATGTTCCAGTGGCCGGCGGCCA
CGCAGGCGGGGCTGGTCGGAGGCACCGTGTTCGCGGCGGCGCACAAGGCGGCGGGGACGA
TGCCGTTCGGCGGCGGGTGCAGCCAGCAGCAAGCGCGGGACGTGGGCGTTTCTCTGGCGA
ACGTAGGAGGAGGCGATGCGTTGTTCGGCGGGGCGCCGCTGGCGAAGGTGGACATGGAAT
GCGGCGAGCAGGCGCCGCAGCTGGACATGGACGACTCCACATGGAGAGCCTTCTGAACAT
GGCCACGCCACCATCAATTTGGATAATTATTAAGCAAACCATGCATACACGTATTATATA
CTCAGTTATATACTAGATGAAGAATTAATGTGGTCGTCATCCAAGATATCCACAGTACAG
TACACTACAGTCAGTTATTAATTAATTAATCAAAAATGAAAGTGTAGTGTTGTCACCTAG
AAAAAATGTGCCGAAAATATTTTGGTGGAGACGGGGCCCTCAAGTTTAATACAAAGCAGT
aagtctattttgcatactcatcttt

CDS

972 bp

>Os03t0624600-01 No apical meristem (NAM) protein domain containing protein.
ATggaggaggggttgccgccggggttccggttccacccgacggacgaggagctggtgacg
tactacctcgcccgcaaggtctccgacttcggcttcgccacccgcgccatcgccgacgtc
gacctcaacaagtgcgagccatgggacctccccagcaaggcaagcatgggggagaaggag
tggtacttcttcagcatgcgcgaccgcaagtacccgacggggatccgcaccaaccgcgcc
acggactccggctactggaagaccaccggcaaggacaaggagatcttccacggcggcgcg
ctcgccggcatgaagaagacgctggtgttctaccgcgggagggcgcccaagggcgccaag
accagctgggtgatgcacgagtacaggctccagtccaagttccccTACAAGCCCGCCAAG
GACGAGTGGGTCGTCTGCCGCGTCTTCAAGAAGCTCCAGTGCCACCTCGCCAAGCCCCGC
CCGCCGCACGACGACGTCGACGGAGACGGCGCCTCGCCGCCGGAGATGGTGGACGCCTCG
TCGCTCGGCGAGCTTGGCGAGCTCGACGTCTCCTCCATCCTCCTCGGCGGCTTCGCGCCG
CCGTCGGGCGAGCTCTGCCATGGCGGCGGCGGCGGAGACGGTTTCGGCGCGCACAGGCTT
CATGTCGGCGCGTACATGAGCTGGCTGCAGGCGGCGGCGGCGGCCAACCAGGGCATGTTC
CAGTGGCCGGCGGCCACGCAGGCGGGGCTGGTCGGAGGCACCGTGTTCGCGGCGGCGCAC
AAGGCGGCGGGGACGATGCCGTTCGGCGGCGGGTGCAGCCAGCAGCAAGCGCGGGACGTG
GGCGTTTCTCTGGCGAACGTAGGAGGAGGCGATGCGTTGTTCGGCGGGGCGCCGCTGGCG
AAGGTGGACATGGAATGCGGCGAGCAGGCGCCGCAGCTGGACATGGACGACTCCACATGG
AGAGCCTTCTGA

Protein

324 aa

>Os03t0624600-01 No apical meristem (NAM) protein domain containing protein.
MEEGLPPGFRFHPTDEELVTYYLARKVSDFGFATRAIADVDLNKCEPWDLPSKASMGEKE
WYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEIFHGGALAGMKKTLVFYRGRAPKGAK
TSWVMHEYRLQSKFPYKPAKDEWVVCRVFKKLQCHLAKPRPPHDDVDGDGASPPEMVDAS
SLGELGELDVSSILLGGFAPPSGELCHGGGGGDGFGAHRLHVGAYMSWLQAAAAANQGMF
QWPAATQAGLVGGTVFAAAHKAAGTMPFGGGCSQQQARDVGVSLANVGGGDALFGGAPLA
KVDMECGEQAPQLDMDDSTWRAF*

5'UTR

chr03:23734580..23734683 (+ strand) : 104 bp

CDS

chr03:23734684..23734837 (+ strand) : 154 bp

chr03:23735476..23736293 (+ strand) : 818 bp

3'UTR

chr03:23736294..23736562 (+ strand) : 269 bp

FASTA

>Os03t0624600-01 class=Sequence position=chr03:23734580..23736562 (+ strand)
ATGGACATTA GCTAGCTCAG CTCAGCTCAC TGCCACTGCC GCTCTGCCTG CCGGCGATCG AGGAGAAGAC CGGCCGGCGG
CGAGCTAGCA GGAGAGGGCT AGTGATggag gaggggttgc cgccggggtt ccggttccac ccgacggacg aggagctggt
gacgtactac ctcgcccgca aggtctccga cttcggcttc gccacccgcg ccatcgccga cgtcgacctc aacaagtgcg
agccatggga cctccccagt aaGTCTCTAG CTAACTCTTC GATTTCGATC CCCAGTAAGT GTGTTTAGCT TTAAAAACGA
GTTTTGAAGG GAGAAATTGT GAGCATATTG AGGATTGAAC ACGGAACATT CGCGGGTTGA AATTGAAGTG CATCTCTAAA
TTGTGTTTAG CTTTGATTCA GCGAGTAATA TAATATGCAT GAATATGTCG TCCATTAATC ATTCTTTGAT CTGCAAGTTG
ATTTTAGGGG AAATGTAGGC TCTTCTGTGT CCCTTTCGGA CTTGTTCAAG AATTCCCTTT TGAGAAGAAA TGCCAAAGGC
CCTGCATGCT TTCATAGAAA GCAGAAGACT TGTTCAATAA TTCTCTCCTT TTAACTCTAT ACACTTTCTT CGATTAAGCT
TTTTCTTATT CTCAGACTCG TTCTTTCTGA TTGGTGAGAA TTGCATTGCC CTCTCGTACC TTTATAGTTG CACCCGAAAA
TTTTAATAAA ATTTCTACAC GTGCACTTAC ATTATTATCG AATTGTACGG GTGTAGTTTA GTGGTCACTG GTGATCATAT
CACTGCATGC ATACACTACA AATGCACACG TACAAATGAA TGAATTGATC AATCGTTCTT ACACATGAAC GCAATGTtga
tggatgtgat atgcaggcaa ggcaagcatg ggggagaagg agtggtactt cttcagcatg cgcgaccgca agtacccgac
ggggatccgc accaaccgcg ccacggactc cggctactgg aagaccaccg gcaaggacaa ggagatcttc cacggcggcg
cgctcgccgg catgaagaag acgctggtgt tctaccgcgg gagggcgccc aagggcgcca agaccagctg ggtgatgcac
gagtacaggc tccagtccaa gttccccTAC AAGCCCGCCA AGGACGAGTG GGTCGTCTGC CGCGTCTTCA AGAAGCTCCA
GTGCCACCTC GCCAAGCCCC GCCCGCCGCA CGACGACGTC GACGGAGACG GCGCCTCGCC GCCGGAGATG GTGGACGCCT
CGTCGCTCGG CGAGCTTGGC GAGCTCGACG TCTCCTCCAT CCTCCTCGGC GGCTTCGCGC CGCCGTCGGG CGAGCTCTGC
CATGGCGGCG GCGGCGGAGA CGGTTTCGGC GCGCACAGGC TTCATGTCGG CGCGTACATG AGCTGGCTGC AGGCGGCGGC
GGCGGCCAAC CAGGGCATGT TCCAGTGGCC GGCGGCCACG CAGGCGGGGC TGGTCGGAGG CACCGTGTTC GCGGCGGCGC
ACAAGGCGGC GGGGACGATG CCGTTCGGCG GCGGGTGCAG CCAGCAGCAA GCGCGGGACG TGGGCGTTTC TCTGGCGAAC
GTAGGAGGAG GCGATGCGTT GTTCGGCGGG GCGCCGCTGG CGAAGGTGGA CATGGAATGC GGCGAGCAGG CGCCGCAGCT
GGACATGGAC GACTCCACAT GGAGAGCCTT CTGAACATGG CCACGCCACC ATCAATTTGG ATAATTATTA AGCAAACCAT
GCATACACGT ATTATATACT CAGTTATATA CTAGATGAAG AATTAATGTG GTCGTCATCC AAGATATCCA CAGTACAGTA
CACTACAGTC AGTTATTAAT TAATTAATCA AAAATGAAAG TGTAGTGTTG TCACCTAGAA AAAATGTGCC GAAAATATTT
TGGTGGAGAC GGGGCCCTCA AGTTTAATAC AAAGCAGTaa gtctattttg catactcatc ttt

Locus: Os03g0624600

Loading...

Locus: Os03g0624600

Loading...