Os03t0633800-01

Locus

Os03g0633800

Description

Similar to IAA6 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA12

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA12

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 12

Transcript Evidence

AK073044 (DDBJ, Best hit)

Protein Evidence

Q75GK1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J033001E11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0633800-01)

RiceXPro (AK073044)

Others

Oryzabase (10524)

KEGG (Os03t0633800-01)

Transcript

1094 bp

>Os03t0633800-01 Similar to IAA6 (Fragment).
ATCTCATCACAGCCAACGCATCGTCTTCCTTCTTCGTCGTCGATAGATCGGCTCTCGAGC
TCACAACCACATCGATCGTCTCCGGCAAGCCGACGTACGTACGACTAGCTAGCTAGAGAG
GAAGCGAGAAATGGAAGCCGCCGTGGGGTACGCCGCCGACAGCCTCATCAAGGCCACCGA
GCTCAGGCTGGGCCTGCCTGGGACAGCCGACGACCTGCCCTCCACGCCCAGGGGCAAGAA
GCGCGCCGCCGCGGCGGAGGACAACAACGCCAACGCCGCCGCCGCCGACGACGACGAGCA
CGACGCCGTCGAGGCCGCGCCGCCGGTAGCCAAGGCTCAAGTGGTCGGGTGGCCGCCGGT
GAGGTCGTACAGGAAGAGCTGCTTCCAGCAACAGTCAGCGGCGGCGAGCAAGAGCAAGGC
CGCCGTGAGCAGCTGCAACAACAAAGACGAGCCCATCACCAAGAACGCGGCGCCGGCGCC
GGCAGCCTCCTCGGCGGCGGCGGCCAACGGCGGGTCGCTGGTGAAGGTGAGCATGGACGG
GGCGCCGTACCTGAGGAAGATCGACCTGAGGATGTACAAGGGCTACAGGGAGCTCCGCGA
GGCCCTGGAGGCCATGTTCGTCTGCTTCTCCGGCGCCGCCGACGGTGCCAACCCGTCGGA
GTTCGCCATCACCTACCAGGACAAGGACGGCGACCTCATGCTCGTCGGCGACGTCCCTTT
CGACATGTTCACCAGCACATGCAAGAAGTTGAGGATCATGAAGAGATCTGAAGCCACAGG
GCTAGGATCACCAAGGCAAATGAAGATCTAATCTAAGAGCGACAAGAGATCGATCGATGC
ATTCCATCAACTTTTCATTTCTTTTTATTTTTTTTCCTCCCAAGCCAAAAAGGAGATGAG
CTTGGGGGCATCAAAGCAAACACATGGATGTGCTTCTGCTTTGTTTCCATCTTTAAAAAC
TAGTAGGTTTTAATTTTATGATTTTAGCAGCACAAAGGAGATGTGGAGATTTGGGTTCAA
CTCTCCATGTGTATGTACAAACGAAACAGTTATTATATATTGATTGTTGGTTACTACTAC
TATACTACTTCAAA

CDS

681 bp

>Os03t0633800-01 Similar to IAA6 (Fragment).
ATGGAAGCCGCCGTGGGGTACGCCGCCGACAGCCTCATCAAGGCCACCGAGCTCAGGCTG
GGCCTGCCTGGGACAGCCGACGACCTGCCCTCCACGCCCAGGGGCAAGAAGCGCGCCGCC
GCGGCGGAGGACAACAACGCCAACGCCGCCGCCGCCGACGACGACGAGCACGACGCCGTC
GAGGCCGCGCCGCCGGTAGCCAAGGCTCAAGTGGTCGGGTGGCCGCCGGTGAGGTCGTAC
AGGAAGAGCTGCTTCCAGCAACAGTCAGCGGCGGCGAGCAAGAGCAAGGCCGCCGTGAGC
AGCTGCAACAACAAAGACGAGCCCATCACCAAGAACGCGGCGCCGGCGCCGGCAGCCTCC
TCGGCGGCGGCGGCCAACGGCGGGTCGCTGGTGAAGGTGAGCATGGACGGGGCGCCGTAC
CTGAGGAAGATCGACCTGAGGATGTACAAGGGCTACAGGGAGCTCCGCGAGGCCCTGGAG
GCCATGTTCGTCTGCTTCTCCGGCGCCGCCGACGGTGCCAACCCGTCGGAGTTCGCCATC
ACCTACCAGGACAAGGACGGCGACCTCATGCTCGTCGGCGACGTCCCTTTCGACATGTTC
ACCAGCACATGCAAGAAGTTGAGGATCATGAAGAGATCTGAAGCCACAGGGCTAGGATCA
CCAAGGCAAATGAAGATCTAA

Protein

227 aa

>Os03t0633800-01 Similar to IAA6 (Fragment).
MEAAVGYAADSLIKATELRLGLPGTADDLPSTPRGKKRAAAAEDNNANAAAADDDEHDAV
EAAPPVAKAQVVGWPPVRSYRKSCFQQQSAAASKSKAAVSSCNNKDEPITKNAAPAPAAS
SAAAANGGSLVKVSMDGAPYLRKIDLRMYKGYRELREALEAMFVCFSGAADGANPSEFAI
TYQDKDGDLMLVGDVPFDMFTSTCKKLRIMKRSEATGLGSPRQMKI*

5'UTR

chr03:24212554..24212683 (+ strand) : 130 bp

CDS

chr03:24212684..24212886 (+ strand) : 203 bp

chr03:24212989..24213378 (+ strand) : 390 bp

chr03:24213488..24213575 (+ strand) : 88 bp

3'UTR

chr03:24213576..24213858 (+ strand) : 283 bp

FASTA

>Os03t0633800-01 class=Sequence position=chr03:24212554..24213858 (+ strand)
ATCTCATCAC AGCCAACGCA TCGTCTTCCT TCTTCGTCGT CGATAGATCG GCTCTCGAGC TCACAACCAC ATCGATCGTC
TCCGGCAAGC CGACGTACGT ACGACTAGCT AGCTAGAGAG GAAGCGAGAA ATGGAAGCCG CCGTGGGGTA CGCCGCCGAC
AGCCTCATCA AGGCCACCGA GCTCAGGCTG GGCCTGCCTG GGACAGCCGA CGACCTGCCC TCCACGCCCA GGGGCAAGAA
GCGCGCCGCC GCGGCGGAGG ACAACAACGC CAACGCCGCC GCCGCCGACG ACGACGAGCA CGACGCCGTC GAGGCCGCGC
CGCCGGTAGC CAAGTGAGTA GCTAGCTTTT CCAGAGATCA TCTTTGACTT TTACGATGAA GCTAGCTAGG GTTCTGAGTT
CTGACATGGC GACTGCCTCC TCCTCCTCCC TGCAGGGCTC AAGTGGTCGG GTGGCCGCCG GTGAGGTCGT ACAGGAAGAG
CTGCTTCCAG CAACAGTCAG CGGCGGCGAG CAAGAGCAAG GCCGCCGTGA GCAGCTGCAA CAACAAAGAC GAGCCCATCA
CCAAGAACGC GGCGCCGGCG CCGGCAGCCT CCTCGGCGGC GGCGGCCAAC GGCGGGTCGC TGGTGAAGGT GAGCATGGAC
GGGGCGCCGT ACCTGAGGAA GATCGACCTG AGGATGTACA AGGGCTACAG GGAGCTCCGC GAGGCCCTGG AGGCCATGTT
CGTCTGCTTC TCCGGCGCCG CCGACGGTGC CAACCCGTCG GAGTTCGCCA TCACCTACCA GGACAAGGAC GGCGACCTCA
TGCTCGTCGG CGACGTCCCT TTCGAGTAAG TTCTTCACAA ACTTTTCATC TCAACAAATC TCTTAATTAA TTAGTAATTT
GCTTATATAT ATATTTGCAG TCAAACTGAT TAAATTTGCT GTTTGATTTT GCAGCATGTT CACCAGCACA TGCAAGAAGT
TGAGGATCAT GAAGAGATCT GAAGCCACAG GGCTAGGATC ACCAAGGCAA ATGAAGATCT AATCTAAGAG CGACAAGAGA
TCGATCGATG CATTCCATCA ACTTTTCATT TCTTTTTATT TTTTTTCCTC CCAAGCCAAA AAGGAGATGA GCTTGGGGGC
ATCAAAGCAA ACACATGGAT GTGCTTCTGC TTTGTTTCCA TCTTTAAAAA CTAGTAGGTT TTAATTTTAT GATTTTAGCA
GCACAAAGGA GATGTGGAGA TTTGGGTTCA ACTCTCCATG TGTATGTACA AACGAAACAG TTATTATATA TTGATTGTTG
GTTACTACTA CTATACTACT TCAAA

Locus: Os03g0633800

Loading...

Locus: Os03g0633800

Loading...