Os03t0636800-01

Locus

Os03g0636800

Description

LSTK-1-like kinase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsNek1

Oryzabase Gene Name Synonym(s)

NIMA-related kinase 1

Transcript Evidence

AK073903 (DDBJ, Best hit)

Protein Evidence

Q10GB1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J033073A22 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0636800-01)

RiceXPro (AK073903)

Others

Oryzabase (9925)

KEGG (Os03t0636800-01 (EC:2.7.11.1))

Transcript

2298 bp

>Os03t0636800-01 LSTK-1-like kinase.
CTTTCCGCCAAATACACAACTACTACTACCCCCTCTCTCTCTCTCCGTTCTCCTTTTCTC
CTCCACGGCAGTTTTATATAAAATTCGCGGCTTTCAAAAGCAAACCAAAACGGCAAAGTT
TGAACTTTGAACTCTCCTCCTCCCCGCACCGCCGCATCCCTTTCTTTCCCCCACCCCTTC
CCGCTACGACAAACCATAGCATATCCTCGTCTCAACACTCTCCTCTGCCTGATCAAAAAA
GAAAATCAAATGCGGTGAGATCTGCGGGGTCGTGATCCTCAAACCATTTGGCTCTGGTAA
CTGCAACTGCAAAACGGCACAGCCATGGAGCAGTACGAGGTACTGGAGCAGATCGGCAAA
GGAGCATTTGGTTCTGCCCTGCTTGTCAGGCACAAGGTGGAGAAGAAGAAGTATGTGTTG
AAAAAGATCCGGCTTGCCAGGCAGACAGACCGCACTCGCAGGTCTGCTCACCAGGAGATG
CAGCTCATTGCCACAGTGAGGAACCCATTCATCGTGGAGTACAAGGATTCATGGGTGGAG
AAGGGTTGCTATGTTTGCATCATTATAGGATACTGTGAAGGAGGAGACATGGCTGAAGCT
ATTAAAAGAGCTACAGGTGATCATTTCTCTGAGGAGAAGCTTTGCAAGTGGCTTGTGCAG
CTCCTCATGGCCCTTGACTATTTGCATGCAAATCACATTCTTCACCGTGATGTGAAGTGC
TCAAACATTTTTCTTACTAGGGATCAAAGTATAAGACTAGGTGACTTTGGGCTTGCAAAA
ATATTGACCTCTGATGATCTAGCATCCTCTGTGGTAGGAACACCAAGTTATATGTGCCCA
GAACTACTTGCTGATATACCTTATGGTACCAAATCTGATATTTGGTCACTAGGATGTTGT
ATATATGAAATGACTGCTCTGAGGCCTGCATTTAAAGCTTTTGATATGCAAGCTCTTATC
AGTAAGATCACCAAGTCAATTGTGTCGCCATTGCCAACTAGATATTCTGGTGCATTTAGG
GGACTTATTAAGAGCATGCTACGAAAAAGTCCAGAACACAGGCCAAGTGCAGCTGAACTA
CTCAAGCATCCACATCTCCAACCCTATGTGCTGCAAGTCCATTTGAAATCTTCTCCTGCT
CGCAACATAATTCCTTCCCATCAGTCTCCGATTGACAAGGTTAAGAAAATGACATTTCCC
ACTGAGTCCATGTGCAGAAGCAAGGGCAGGAGAAACTCTTTGGGTAATGAGAGAATCGTG
ACCTTCAGCAAACCTTCTCCTGAAAGGAAGTTTACTAGTTCTATTCAGAGTATCAAGGAT
TACTCAACTACTCGGAGTGTCAAAGATTTATCTATCGATGTTAGTTTGGTCGAGGAGGTT
AGTAGTAAAACAACTTTTACCACAAGAACATCGAGTATTGTGAAGACTCCCAAGAGAACT
CCAAGCAAAACAATCACAACTCCCCAGTTAGAACCTCCAAAGGTATCTTACAACAGAGTA
AATCGGAGCGAGCTGCTTTCAAGAACACCGGTGAACAGAAGCGCTCGGGTAATCCGCAGA
GCTTCCCTCCCACTCCCACTGCCATCATCCGAGACACCGAAGCGCGGCGTCAGCAGCATC
AGCATCCTCGAGCAGCTGGAATCCCCCGACGTATCCGTGAATTCGCCTCGGATAGACCGG
ATCGCCGAGTTCCCGCTGGCCTCATCCGAAGATCCACCGTTCCTCAAGCTCCACGGACGC
CGCTCTCCAACTCCAACGCCACAGCATTGCGTCATCGACCAGTCGATCACCAAGGACAAA
TGCATGGTCGAAGCGTTCCACATCAtcgacgtcgatgacgacgacgggaggagcgactcg
tcgtcgggccgtaacaacgccgcggcggctgcctcgagccgcgccggctcgtcggagtcg
acgaggcagcggcgGTTCGACACGTCGTCGTACCAGCAGCGCGCGGAGGCGCTGGAGGGG
CTGCTGGAGTTCAGCGCGCAGCTGCTGCAGCAGGAGAGGTACGACGAGCTGGGCGTCCTG
CTCAAGCCATTCGGCCCGGAGAAGGTGTCCCCGAGGGAGACGGCCATCTGGCTCACCAAG
AGCTTCAAGGAGACAGGGCTGTAAGCATATGCGATCACTCTCACCTTGCTCTAGAAAACA
AATGAGCAGAAGCAAATTAAATTGTAGCTCAGGAAAGATTAGTTGCTGACAGTGTGACAC
CATCTCAGTGTTGCCTCCCCCAACTAGCTTATGAAAGATTATTCAGTGATCATCTATGGA
TTAACAAGGAAGTAGCGG

CDS

1800 bp

>Os03t0636800-01 LSTK-1-like kinase.
ATGGAGCAGTACGAGGTACTGGAGCAGATCGGCAAAGGAGCATTTGGTTCTGCCCTGCTT
GTCAGGCACAAGGTGGAGAAGAAGAAGTATGTGTTGAAAAAGATCCGGCTTGCCAGGCAG
ACAGACCGCACTCGCAGGTCTGCTCACCAGGAGATGCAGCTCATTGCCACAGTGAGGAAC
CCATTCATCGTGGAGTACAAGGATTCATGGGTGGAGAAGGGTTGCTATGTTTGCATCATT
ATAGGATACTGTGAAGGAGGAGACATGGCTGAAGCTATTAAAAGAGCTACAGGTGATCAT
TTCTCTGAGGAGAAGCTTTGCAAGTGGCTTGTGCAGCTCCTCATGGCCCTTGACTATTTG
CATGCAAATCACATTCTTCACCGTGATGTGAAGTGCTCAAACATTTTTCTTACTAGGGAT
CAAAGTATAAGACTAGGTGACTTTGGGCTTGCAAAAATATTGACCTCTGATGATCTAGCA
TCCTCTGTGGTAGGAACACCAAGTTATATGTGCCCAGAACTACTTGCTGATATACCTTAT
GGTACCAAATCTGATATTTGGTCACTAGGATGTTGTATATATGAAATGACTGCTCTGAGG
CCTGCATTTAAAGCTTTTGATATGCAAGCTCTTATCAGTAAGATCACCAAGTCAATTGTG
TCGCCATTGCCAACTAGATATTCTGGTGCATTTAGGGGACTTATTAAGAGCATGCTACGA
AAAAGTCCAGAACACAGGCCAAGTGCAGCTGAACTACTCAAGCATCCACATCTCCAACCC
TATGTGCTGCAAGTCCATTTGAAATCTTCTCCTGCTCGCAACATAATTCCTTCCCATCAG
TCTCCGATTGACAAGGTTAAGAAAATGACATTTCCCACTGAGTCCATGTGCAGAAGCAAG
GGCAGGAGAAACTCTTTGGGTAATGAGAGAATCGTGACCTTCAGCAAACCTTCTCCTGAA
AGGAAGTTTACTAGTTCTATTCAGAGTATCAAGGATTACTCAACTACTCGGAGTGTCAAA
GATTTATCTATCGATGTTAGTTTGGTCGAGGAGGTTAGTAGTAAAACAACTTTTACCACA
AGAACATCGAGTATTGTGAAGACTCCCAAGAGAACTCCAAGCAAAACAATCACAACTCCC
CAGTTAGAACCTCCAAAGGTATCTTACAACAGAGTAAATCGGAGCGAGCTGCTTTCAAGA
ACACCGGTGAACAGAAGCGCTCGGGTAATCCGCAGAGCTTCCCTCCCACTCCCACTGCCA
TCATCCGAGACACCGAAGCGCGGCGTCAGCAGCATCAGCATCCTCGAGCAGCTGGAATCC
CCCGACGTATCCGTGAATTCGCCTCGGATAGACCGGATCGCCGAGTTCCCGCTGGCCTCA
TCCGAAGATCCACCGTTCCTCAAGCTCCACGGACGCCGCTCTCCAACTCCAACGCCACAG
CATTGCGTCATCGACCAGTCGATCACCAAGGACAAATGCATGGTCGAAGCGTTCCACATC
Atcgacgtcgatgacgacgacgggaggagcgactcgtcgtcgggccgtaacaacgccgcg
gcggctgcctcgagccgcgccggctcgtcggagtcgacgaggcagcggcgGTTCGACACG
TCGTCGTACCAGCAGCGCGCGGAGGCGCTGGAGGGGCTGCTGGAGTTCAGCGCGCAGCTG
CTGCAGCAGGAGAGGTACGACGAGCTGGGCGTCCTGCTCAAGCCATTCGGCCCGGAGAAG
GTGTCCCCGAGGGAGACGGCCATCTGGCTCACCAAGAGCTTCAAGGAGACAGGGCTGTAA

Protein

600 aa

>Os03t0636800-01 LSTK-1-like kinase.
MEQYEVLEQIGKGAFGSALLVRHKVEKKKYVLKKIRLARQTDRTRRSAHQEMQLIATVRN
PFIVEYKDSWVEKGCYVCIIIGYCEGGDMAEAIKRATGDHFSEEKLCKWLVQLLMALDYL
HANHILHRDVKCSNIFLTRDQSIRLGDFGLAKILTSDDLASSVVGTPSYMCPELLADIPY
GTKSDIWSLGCCIYEMTALRPAFKAFDMQALISKITKSIVSPLPTRYSGAFRGLIKSMLR
KSPEHRPSAAELLKHPHLQPYVLQVHLKSSPARNIIPSHQSPIDKVKKMTFPTESMCRSK
GRRNSLGNERIVTFSKPSPERKFTSSIQSIKDYSTTRSVKDLSIDVSLVEEVSSKTTFTT
RTSSIVKTPKRTPSKTITTPQLEPPKVSYNRVNRSELLSRTPVNRSARVIRRASLPLPLP
SSETPKRGVSSISILEQLESPDVSVNSPRIDRIAEFPLASSEDPPFLKLHGRRSPTPTPQ
HCVIDQSITKDKCMVEAFHIIDVDDDDGRSDSSSGRNNAAAAASSRAGSSESTRQRRFDT
SSYQQRAEALEGLLEFSAQLLQQERYDELGVLLKPFGPEKVSPRETAIWLTKSFKETGL*

5'UTR

chr03:24356989..24357284 (- strand) : 296 bp

chr03:24356088..24356115 (- strand) : 28 bp

CDS

chr03:24356002..24356087 (- strand) : 86 bp

chr03:24355790..24355856 (- strand) : 67 bp

chr03:24355447..24355512 (- strand) : 66 bp

chr03:24355240..24355286 (- strand) : 47 bp

chr03:24355077..24355122 (- strand) : 46 bp

chr03:24354893..24354973 (- strand) : 81 bp

chr03:24354755..24354797 (- strand) : 43 bp

chr03:24354615..24354664 (- strand) : 50 bp

chr03:24354457..24354538 (- strand) : 82 bp

chr03:24354320..24354369 (- strand) : 50 bp

chr03:24353768..24353841 (- strand) : 74 bp

chr03:24353624..24353675 (- strand) : 52 bp

chr03:24353089..24353532 (- strand) : 444 bp

chr03:24352149..24352760 (- strand) : 612 bp

3'UTR

chr03:24351975..24352148 (- strand) : 174 bp

FASTA

>Os03t0636800-01 class=Sequence position=chr03:24351975..24357284 (- strand)
CTTTCCGCCA AATACACAAC TACTACTACC CCCTCTCTCT CTCTCCGTTC TCCTTTTCTC CTCCACGGCA GTTTTATATA
AAATTCGCGG CTTTCAAAAG CAAACCAAAA CGGCAAAGTT TGAACTTTGA ACTCTCCTCC TCCCCGCACC GCCGCATCCC
TTTCTTTCCC CCACCCCTTC CCGCTACGAC AAACCATAGC ATATCCTCGT CTCAACACTC TCCTCTGCCT GATCAAAAAA
GAAAATCAAA TGCGGTGAGA TCTGCGGGGT CGTGATCCTC AAACCATTTG GCTCTGGTAA TCTTCTTCTC TCCCTGGTAA
ATTAATCTGC TCTATTCTCT TCCGTAGATA GCTTGCATGC ATCATGAATG CATTGGTTGG TTGATGGTTG GAGTTGAGAG
GAAGCGGTTT TGCTGGGCTG GGGTGGTGGT TTTGGTGGGT TCTGTGTTCT TGCGGCGTGA AGCGGTTGGT GCTCCTGGGT
TGTTTTTTTC TTTTTCTTTT TTTTTTTCCA AAAGCTTTGG TTTTTTGTTT TTTTGGGGGT CTTTTGATTT TTTTTGTGTG
TTTTTGGCAC CGCACACGCT GATTCTTGGA GGTGGTTTTG GTGGTGTACT GCCCATGGGA TTTAATGGGC TCGCATTGTT
TTCGTGGTTT TGACGTGTTG TTTACCTCTC TTGTGTTCAT GCGGATGAAC AAGTAATGCC CCTCTTTCTC TCTCTCTTTC
TCTCGAGGAG CTCGTGAATT TGTTTTTCTT TTCACAATTG TCTTTTGGAC TTCGAGCTGC GTGCTTTTTT GGTTCTGAGC
AAAAAGAAAA AACACTTTTA TCTTTTCCGC TGGATTTGAC ATTTTGCAAT GTTATGCAAT GTGTTCTTCG GTTTGGCATT
TTGGGGTTCA GAGTTCCATT TCGGAGAAGG GGAAAAAGCT TCAGTCTTGG TCGGCTATTT TGTCGGAAAG CGTGCCGCAT
TCGTGTCACA TGCCGCAATT TTTTCTTTCT CCTGAGTTCA CACTTTTCTT TCTTTCTTTC CTTGCCGTCG GCAATTTTGG
CACCATTTTA TGTGCGGTGA AAATGTGTCG GCATTTCACT GTAAATCTTC CAAACCCCGG TCCACAATGT TAATTCCCCT
CTTATAGTCC AACTGCAACA TTATTAGTAT CATGCCAATT TCTCTTCAGG TAACTGCAAC TGCAAAACGG CACAGCCATG
GAGCAGTACG AGGTACTGGA GCAGATCGGC AAAGGAGCAT TTGGTTCTGC CCTGCTTGTC AGGCACAAGG TGGAGAAGAA
GAAGTGAGAC TAGAACCACC ACCACCACAT TTGCTCTTGT CCCGGATGAA AAAAAGAAGA AATCAAGAAA ATATATGTCA
ACCACCTTTT GGTATCTGCA TCTTGTTCCA CCCAATCTGA TCTTTTGGAG CCTGTGAACT GTATGCAGGT ATGTGTTGAA
AAAGATCCGG CTTGCCAGGC AGACAGACCG CACTCGCAGG TCTGCTCACC AGGAGGTAAG CAACTTCTCC TTTGCATGTC
TTCATCATGT TTTGCACTAC CTACTTTAGT TATGATTTCA CACACAATGT CTTGTGTTCA CAAAGAACGA GTTGTGTGCA
GGTCAACTCT TGGTACACAA TGATTAGTGT TCCTGACTGG TTTAGGGGCT ATTGTTCATC CTGTTCTTCT CTGTAGTACT
AGATGTGTGA ACTGGTCTGA ACTAAGAGGG TTTTTGCCCT ATTGTTATGG TGTTCTTTGT ACACTTATAC CAGATCTTGA
ATTTGAATGC AGATGCAGCT CATTGCCACA GTGAGGAACC CATTCATCGT GGAGTACAAG GATTCATGGG TGGAGAAGGT
TTGTACCAGT AAACAGGAAC AAAGACCAAT GTCTCAAGTA GATAATTCAG CTTTGGTTTC TAAGAGGAAG ATAATACGTT
GTTCTGGACC ACCATTACTC GTAGGATCCA ATTTCTATTT GAAAAGTTTA ACTAGGAATA TTTTCCCCCC AATTTCAGGG
TTGCTATGTT TGCATCATTA TAGGATACTG TGAAGGAGGA GACATGTATG TATCTCTCTT TAGTCTTTAG CTGTAATGTG
ATGTTTCCCA TTCCATTGTC AAACTTGGTA GTGTTGGTTT TGTTGCCGAT ATCAACTCTC TCTCTCTCTC TCTCTGGTCC
AGGGCTGAAG CTATTAAAAG AGCTACAGGT GATCATTTCT CTGAGGAGGT ATAACTTACC ATTTTAGTTT TCATTTCAAC
AATTTTAACT TGTCCCTTGG TAGAGGGCAT TCAATTCACC ACCAACTTCT TTTTTTAATC TCATTTCGCA GAAGCTTTGC
AAGTGGCTTG TGCAGCTCCT CATGGCCCTT GACTATTTGC ATGCAAATCA CATTCTTCAC CGTGATGTGA AGGTGCGTAA
TGTTGCAATG TTTGATTCTG AAACACATTT GCAACCTGGA ATTGTTACCA TGTTTTCTGA AGTTGTCCCT TTTTTTTTCT
GTTTCAGTGC TCAAACATTT TTCTTACTAG GGATCAAAGT ATAAGACTAG GTATGCCAAC TTCCATTTTC ACAAGTGCAT
GCTTCATAGG AGTTCACATA ATTCTGGATG CAATCTAATT CCTGTTCAAT ATACATGCAG GTGACTTTGG GCTTGCAAAA
ATATTGACCT CTGATGATCT AGCATCCTCT GTTAGTTCTT AAAAATATCA TTTCTCTAGT GCACGTTCCA TTATATTGGT
GGCGGCAACT TATTCTAATC ATGCAGGTGG TAGGAACACC AAGTTATATG TGCCCAGAAC TACTTGCTGA TATACCTTAT
GGTACCAAAT CTGATATTTG GTCACTAGGT AAATGCTTCA GTTGGATGTA AATTACATTA GTCCACAGTT AGATATCTGC
CCTGGTGCTT AATGCTTAAA TATCTCTGTT TTCAGGATGT TGTATATATG AAATGACTGC TCTGAGGCCT GCATTTAAAG
CTTTTGTAAG TTTTGAGATC GCTTATATTG GCTGGTCATG TAATCATTCA ACTGAATTGT GCAAGTTGAT TTCTGAATTA
AATGTGGCTT AATATACGCT TTACCTTTCT TATTGTACTC AGTTTTCCGC TTATCTTCCT TTTGAATGGT TAGCATAGTT
TTTTTTTTCC TTTCTCGAAC ACGTAGGAGA TTATCATTAT CTGGTATATA TAAAATGACA CAGGGAGGGA AATCCGGAAA
CTCCCCACCC TAAACACTAA AACACATTAC AAAAACTGAA AAAACACCAA CAAGACCACT TAAGCTGCAA GGGCTATCGA
CCTAGCCAGC AACATGTGTG TTTTGTTAAT TGGCTCTTTT AACTGCATTT TTATCAAATC AACTTGGGAG AATTCATAAG
AGATACATTT AGACCTCTTG TTTCATCTAG TTGTTGAGCA ACTTTCAATT GATTGTTTCT GATTTTGTCA TATCTTCCAT
CAGGATATGC AAGCTCTTAT CAGTAAGATC ACCAAGTCAA TTGTGTCGCC ATTGCCAACT AGATATTCTG GTGCATTGTG
AGTTTCCATG AGTTAATACT TGATTGTCTT CTTAATCCAT CTTGTAAATT TACTTGAGTA ATATCTCTGA AAGCTTTACC
ATCATGCAGT AGGGGACTTA TTAAGAGCAT GCTACGAAAA AGTCCAGAAC ACAGGCCAAG TGTAATTCTC AGTAACTCTC
TTATGTTCAT GTCAGTTACT AATAACATAT GTTTATTCTG ATAAGAGTTT TGCATCATTT TTTTCCCTAC AGGCAGCTGA
ACTACTCAAG CATCCACATC TCCAACCCTA TGTGCTGCAA GTCCATTTGA AATCTTCTCC TGCTCGCAAC ATAATTCCTT
CCCATCAGTC TCCGATTGAC AAGGTTAAGA AAATGACATT TCCCACTGAG TCCATGTGCA GAAGCAAGGG CAGGAGAAAC
TCTTTGGGTA ATGAGAGAAT CGTGACCTTC AGCAAACCTT CTCCTGAAAG GAAGTTTACT AGTTCTATTC AGAGTATCAA
GGATTACTCA ACTACTCGGA GTGTCAAAGA TTTATCTATC GATGTTAGTT TGGTCGAGGA GGTTAGTAGT AAAACAACTT
TTACCACAAG AACATCGAGT ATTGTGAAGA CTCCCAAGAG AACTCCAAGC AAAACAATCA CAACTCCCCA GTTAGAACCT
CCAAAGGTAT CTTACAACAG AGTAAATCGG AGCGAGGTAT GACACATTTA CCATGTTTTA AATGCAGTTT GTAGCACTCT
TATTTACAAC CTGTTTATAG CATGTTCTAA TGCACTTGCA CTAATTGCCC GGTGCGATGT ACTTTTTTTG ACGTCCATTT
GGTGTTCATC TTTCAAACTG AACCTTGCGT AAATATACAT AGATAGAAGA ACATCCATCA ATGAACTGCT AGATGCATTG
TTTCAGTCTG AGCACGCATT ACTGTTCTTA CATTTCATTA CTTCATACAC TAAACCGCTC ACTGTAGTTT CCTGAAGAAT
TTATTTTCAG TAATTGAATT CCTACTTTTT TTCCCATTCT CTAGCTGCTT TCAAGAACAC CGGTGAACAG AAGCGCTCGG
GTAATCCGCA GAGCTTCCCT CCCACTCCCA CTGCCATCAT CCGAGACACC GAAGCGCGGC GTCAGCAGCA TCAGCATCCT
CGAGCAGCTG GAATCCCCCG ACGTATCCGT GAATTCGCCT CGGATAGACC GGATCGCCGA GTTCCCGCTG GCCTCATCCG
AAGATCCACC GTTCCTCAAG CTCCACGGAC GCCGCTCTCC AACTCCAACG CCACAGCATT GCGTCATCGA CCAGTCGATC
ACCAAGGACA AATGCATGGT CGAAGCGTTC CACATCAtcg acgtcgatga cgacgacggg aggagcgact cgtcgtcggg
ccgtaacaac gccgcggcgg ctgcctcgag ccgcgccggc tcgtcggagt cgacgaggca gcggcgGTTC GACACGTCGT
CGTACCAGCA GCGCGCGGAG GCGCTGGAGG GGCTGCTGGA GTTCAGCGCG CAGCTGCTGC AGCAGGAGAG GTACGACGAG
CTGGGCGTCC TGCTCAAGCC ATTCGGCCCG GAGAAGGTGT CCCCGAGGGA GACGGCCATC TGGCTCACCA AGAGCTTCAA
GGAGACAGGG CTGTAAGCAT ATGCGATCAC TCTCACCTTG CTCTAGAAAA CAAATGAGCA GAAGCAAATT AAATTGTAGC
TCAGGAAAGA TTAGTTGCTG ACAGTGTGAC ACCATCTCAG TGTTGCCTCC CCCAACTAGC TTATGAAAGA TTATTCAGTG
ATCATCTATG GATTAACAAG GAAGTAGCGG 

Locus: Os03g0636800

Loading...

Locus: Os03g0636800

Loading...