Os03t0636800-02

Locus

Os03g0636800

Description

Similar to cDNA clone:J033073A22, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsNek1

Oryzabase Gene Name Synonym(s)

NIMA-related kinase 1

Transcript Evidence

AK073129 (DDBJ, Best hit)

Protein Evidence

B7EMV6 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J033004H20 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0636800-02)

Others

Oryzabase (9925)

Transcript

2479 bp

>Os03t0636800-02 Similar to cDNA clone:J033073A22, full insert sequence.
ACTTTGAACTCTCCTCCTCCCCGCACCGCCGCATCCCTTTCTTTCCCCCACCCCTTCCCG
CTACGACAAACCATAGCATATCCTCGTCTCAACACTCTCCTCTGCCTGATCAAAAAAGAA
AATCAAATGCGGTGAGATCTGCGGGGTCGTGATCCTCAAACCATTTGGCTCTGGTAACTG
CAACTGCAAAACGGCACAGCCATGGAGCAGTACGAGGTACTGGAGCAGATCGGCAAAGGA
GCATTTGGTTCTGCCCTGCTTGTCAGGCACAAGGTGGAGAAGAAGAAGTATGTGTTGAAA
AAGATCCGGCTTGCCAGGCAGACAGACCGCACTCGCAGGTCTGCTCACCAGGAGATGCAG
CTCATTGCCACAGTGAGGAACCCATTCATCGTGGAGTACAAGGATTCATGGGTGGAGAAG
GGTTGCTATGTTTGCATCATTATAGGATACTGTGAAGGAGGAGACATGGCTGAAGCTATT
AAAAGAGCTACAGGTGATCATTTCTCTGAGGAGAAGCTTTGCAAGTGGCTTGTGCAGCTC
CTCATGGCCCTTGACTATTTGCATGCAAATCACATTCTTCACCGTGATGTGAAGGGATCA
AAGTATAAGACTAGGTGACTTTGGGCTTGCAAAAATATTGACCTCTGATGATCTAGCATC
CTCTGTGGTAGGAACACCAAGTTATATGTGCCCAGAACTACTTGCTGATATACCTTATGG
TACCAAATCTGATATTTGGTCACTAGGATGTTGTATATATGAAATGACTGCTCTGAGGCC
TGCATTTAAAGCTTTTGATATGCAAGCTCTTATCAGTAAGATCACCAAGTCAATTGTGTC
GCCATTGCCAACTAGATATTCTGGTGCATTTAGGGGACTTATTAAGAGCATGCTACGAAA
AAGTCCAGAACACAGGCCAAGTGCAGCTGAACTACTCAAGCATCCACATCTCCAACCCTA
TGTGCTGCAAGTCCATTTGAAATCTTCTCCTGCTCGCAACATAATTCCTTCCCATCAGTC
TCCGATTGACAAGGTTAAGAAAATGACATTTCCCACTGAGTCCATGTGCAGAAGCAAGGG
CAGGAGAAACTCTTTGGGTAATGAGAGAATCGTGACCTTCAGCAAACCTTCTCCTGAAAG
GAAGTTTACTAGTTCTATTCAGAGTATCAAGGATTACTCAACTACTCGGAGTGTCAAAGA
TTTATCTATCGATGTTAGTTTGGTCGAGGAGGTTAGTAGTAAAACAACTTTTACCACAAG
AACATCGAGTATTGTGAAGACTCCCAAGAGAACTCCAAGCAAAACAATCACAACTCCCCA
GTTAGAACCTCCAAAGGTATCTTACAACAGAGTAAATCGGAGCGAGCTGCTTTCAAGAAC
ACCGGTGAACAGAAGCGCTCGGGTAATCCGCAGAGCTTCCCTCCCACTCCCACTGCCATC
ATCCGAGACACCGAAGCGCGGCGTCAGCAGCATCAGCATCCTCGAGCAGCTGGAATCCCC
CGACGTATCCGTGAATTCGCCTCGGATAGACCGGATCGCCGAGTTCCCGCTGGCCTCATC
CGAAGATCCACCGTTCCTCAAGCTCCACGGACGCCGCTCTCCAACTCCAACGCCACAGCA
TTGCGTCATCGACCAGTCGATCACCAAGGACAAATGCATGGTCGAAGCGTTCCACATCAt
cgacgtcgatgacgacgacgggaggagcgactcgtcgtcgggccgtaacaacgccgcggc
ggctgcctcgagccgcgccggctcgtcggagtcgacgaggcagcggcgGTTCGACACGTC
GTCGTACCAGCAGCGCGCGGAGGCGCTGGAGGGGCTGCTGGAGTTCAGCGCGCAGCTGCT
GCAGCAGGAGAGGTACGACGAGCTGGGCGTCCTGCTCAAGCCATTCGGCCCGGAGAAGGT
GTCCCCGAGGGAGACGGCCATCTGGCTCACCAAGAGCTTCAAGGAGACAGGGCTGTAAGC
ATATGCGATCACTCTCACCTTGCTCTAGAAAACAAATGAGCAGAAGCAAATTAAATTGTA
GCTCAGGAAAGATTAGTTGCTGACAGTGTGACACCATCTCAGTGTTGCCTCCCCCAACTA
GCTTATGAAAGATTATTCAGTGATCATCTATGGATTAACAAGGAAGTAGCGGTAGTTCTA
TACTTCTATGTGGTGTTGGTCTGAAGCAGGAAGTAGTAGTAGTTCATGTTTCTAACCATG
TAGGAGTACTTGACAGGTAAACTGGGCATTCCAGCCCGGCTGAAGAATCATCCAGTTGAT
TGATTTTGTTTCTGTTTGAATAGCATTTCTCTTGTTCATGTAATCTTGAGTTATTGAAGG
TTTAGAGAGAGAGAGAGAGAGAGCTGCTTGCCTTGTATTATCCAAAGTAGGAATTCAGAC
AATGGCCATATCTGATGGAGACAACAAGAAGAATTTGAGGAGCTTGTACTGTACTATGCA
CAAAGATAACGTTCTTGTC

CDS

417 bp

>Os03t0636800-02 Similar to cDNA clone:J033073A22, full insert sequence.
ATGGAGCAGTACGAGGTACTGGAGCAGATCGGCAAAGGAGCATTTGGTTCTGCCCTGCTT
GTCAGGCACAAGGTGGAGAAGAAGAAGTATGTGTTGAAAAAGATCCGGCTTGCCAGGCAG
ACAGACCGCACTCGCAGGTCTGCTCACCAGGAGATGCAGCTCATTGCCACAGTGAGGAAC
CCATTCATCGTGGAGTACAAGGATTCATGGGTGGAGAAGGGTTGCTATGTTTGCATCATT
ATAGGATACTGTGAAGGAGGAGACATGGCTGAAGCTATTAAAAGAGCTACAGGTGATCAT
TTCTCTGAGGAGAAGCTTTGCAAGTGGCTTGTGCAGCTCCTCATGGCCCTTGACTATTTG
CATGCAAATCACATTCTTCACCGTGATGTGAAGGGATCAAAGTATAAGACTAGGTGA

Protein

139 aa

>Os03t0636800-02 Similar to cDNA clone:J033073A22, full insert sequence.
MEQYEVLEQIGKGAFGSALLVRHKVEKKKYVLKKIRLARQTDRTRRSAHQEMQLIATVRN
PFIVEYKDSWVEKGCYVCIIIGYCEGGDMAEAIKRATGDHFSEEKLCKWLVQLLMALDYL
HANHILHRDVKGSKYKTR*

5'UTR

chr03:24356989..24357161 (- strand) : 173 bp

chr03:24356088..24356115 (- strand) : 28 bp

CDS

chr03:24356002..24356087 (- strand) : 86 bp

chr03:24355790..24355856 (- strand) : 67 bp

chr03:24355447..24355512 (- strand) : 66 bp

chr03:24355240..24355286 (- strand) : 47 bp

chr03:24355077..24355122 (- strand) : 46 bp

chr03:24354893..24354973 (- strand) : 81 bp

chr03:24354755..24354774 (- strand) : 20 bp

chr03:24354661..24354664 (- strand) : 4 bp

3'UTR

chr03:24354615..24354660 (- strand) : 46 bp

chr03:24354457..24354538 (- strand) : 82 bp

chr03:24354320..24354369 (- strand) : 50 bp

chr03:24353768..24353841 (- strand) : 74 bp

chr03:24353624..24353675 (- strand) : 52 bp

chr03:24353089..24353532 (- strand) : 444 bp

chr03:24351648..24352760 (- strand) : 1113 bp

FASTA

>Os03t0636800-02 class=Sequence position=chr03:24351648..24357161 (- strand)
ACTTTGAACT CTCCTCCTCC CCGCACCGCC GCATCCCTTT CTTTCCCCCA CCCCTTCCCG CTACGACAAA CCATAGCATA
TCCTCGTCTC AACACTCTCC TCTGCCTGAT CAAAAAAGAA AATCAAATGC GGTGAGATCT GCGGGGTCGT GATCCTCAAA
CCATTTGGCT CTGGTAATCT TCTTCTCTCC CTGGTAAATT AATCTGCTCT ATTCTCTTCC GTAGATAGCT TGCATGCATC
ATGAATGCAT TGGTTGGTTG ATGGTTGGAG TTGAGAGGAA GCGGTTTTGC TGGGCTGGGG TGGTGGTTTT GGTGGGTTCT
GTGTTCTTGC GGCGTGAAGC GGTTGGTGCT CCTGGGTTGT TTTTTTCTTT TTCTTTTTTT TTTTCCAAAA GCTTTGGTTT
TTTGTTTTTT TGGGGGTCTT TTGATTTTTT TTGTGTGTTT TTGGCACCGC ACACGCTGAT TCTTGGAGGT GGTTTTGGTG
GTGTACTGCC CATGGGATTT AATGGGCTCG CATTGTTTTC GTGGTTTTGA CGTGTTGTTT ACCTCTCTTG TGTTCATGCG
GATGAACAAG TAATGCCCCT CTTTCTCTCT CTCTTTCTCT CGAGGAGCTC GTGAATTTGT TTTTCTTTTC ACAATTGTCT
TTTGGACTTC GAGCTGCGTG CTTTTTTGGT TCTGAGCAAA AAGAAAAAAC ACTTTTATCT TTTCCGCTGG ATTTGACATT
TTGCAATGTT ATGCAATGTG TTCTTCGGTT TGGCATTTTG GGGTTCAGAG TTCCATTTCG GAGAAGGGGA AAAAGCTTCA
GTCTTGGTCG GCTATTTTGT CGGAAAGCGT GCCGCATTCG TGTCACATGC CGCAATTTTT TCTTTCTCCT GAGTTCACAC
TTTTCTTTCT TTCTTTCCTT GCCGTCGGCA ATTTTGGCAC CATTTTATGT GCGGTGAAAA TGTGTCGGCA TTTCACTGTA
AATCTTCCAA ACCCCGGTCC ACAATGTTAA TTCCCCTCTT ATAGTCCAAC TGCAACATTA TTAGTATCAT GCCAATTTCT
CTTCAGGTAA CTGCAACTGC AAAACGGCAC AGCCATGGAG CAGTACGAGG TACTGGAGCA GATCGGCAAA GGAGCATTTG
GTTCTGCCCT GCTTGTCAGG CACAAGGTGG AGAAGAAGAA GTGAGACTAG AACCACCACC ACCACATTTG CTCTTGTCCC
GGATGAAAAA AAGAAGAAAT CAAGAAAATA TATGTCAACC ACCTTTTGGT ATCTGCATCT TGTTCCACCC AATCTGATCT
TTTGGAGCCT GTGAACTGTA TGCAGGTATG TGTTGAAAAA GATCCGGCTT GCCAGGCAGA CAGACCGCAC TCGCAGGTCT
GCTCACCAGG AGGTAAGCAA CTTCTCCTTT GCATGTCTTC ATCATGTTTT GCACTACCTA CTTTAGTTAT GATTTCACAC
ACAATGTCTT GTGTTCACAA AGAACGAGTT GTGTGCAGGT CAACTCTTGG TACACAATGA TTAGTGTTCC TGACTGGTTT
AGGGGCTATT GTTCATCCTG TTCTTCTCTG TAGTACTAGA TGTGTGAACT GGTCTGAACT AAGAGGGTTT TTGCCCTATT
GTTATGGTGT TCTTTGTACA CTTATACCAG ATCTTGAATT TGAATGCAGA TGCAGCTCAT TGCCACAGTG AGGAACCCAT
TCATCGTGGA GTACAAGGAT TCATGGGTGG AGAAGGTTTG TACCAGTAAA CAGGAACAAA GACCAATGTC TCAAGTAGAT
AATTCAGCTT TGGTTTCTAA GAGGAAGATA ATACGTTGTT CTGGACCACC ATTACTCGTA GGATCCAATT TCTATTTGAA
AAGTTTAACT AGGAATATTT TCCCCCCAAT TTCAGGGTTG CTATGTTTGC ATCATTATAG GATACTGTGA AGGAGGAGAC
ATGTATGTAT CTCTCTTTAG TCTTTAGCTG TAATGTGATG TTTCCCATTC CATTGTCAAA CTTGGTAGTG TTGGTTTTGT
TGCCGATATC AACTCTCTCT CTCTCTCTCT CTGGTCCAGG GCTGAAGCTA TTAAAAGAGC TACAGGTGAT CATTTCTCTG
AGGAGGTATA ACTTACCATT TTAGTTTTCA TTTCAACAAT TTTAACTTGT CCCTTGGTAG AGGGCATTCA ATTCACCACC
AACTTCTTTT TTTAATCTCA TTTCGCAGAA GCTTTGCAAG TGGCTTGTGC AGCTCCTCAT GGCCCTTGAC TATTTGCATG
CAAATCACAT TCTTCACCGT GATGTGAAGG TGCGTAATGT TGCAATGTTT GATTCTGAAA CACATTTGCA ACCTGGAATT
GTTACCATGT TTTCTGAAGT TGTCCCTTTT TTTTTCTGTT TCAGTGCTCA AACATTTTTC TTACTAGGGA TCAAAGTATA
AGACTAGGTA TGCCAACTTC CATTTTCACA AGTGCATGCT TCATAGGAGT TCACATAATT CTGGATGCAA TCTAATTCCT
GTTCAATATA CATGCAGGTG ACTTTGGGCT TGCAAAAATA TTGACCTCTG ATGATCTAGC ATCCTCTGTT AGTTCTTAAA
AATATCATTT CTCTAGTGCA CGTTCCATTA TATTGGTGGC GGCAACTTAT TCTAATCATG CAGGTGGTAG GAACACCAAG
TTATATGTGC CCAGAACTAC TTGCTGATAT ACCTTATGGT ACCAAATCTG ATATTTGGTC ACTAGGTAAA TGCTTCAGTT
GGATGTAAAT TACATTAGTC CACAGTTAGA TATCTGCCCT GGTGCTTAAT GCTTAAATAT CTCTGTTTTC AGGATGTTGT
ATATATGAAA TGACTGCTCT GAGGCCTGCA TTTAAAGCTT TTGTAAGTTT TGAGATCGCT TATATTGGCT GGTCATGTAA
TCATTCAACT GAATTGTGCA AGTTGATTTC TGAATTAAAT GTGGCTTAAT ATACGCTTTA CCTTTCTTAT TGTACTCAGT
TTTCCGCTTA TCTTCCTTTT GAATGGTTAG CATAGTTTTT TTTTTCCTTT CTCGAACACG TAGGAGATTA TCATTATCTG
GTATATATAA AATGACACAG GGAGGGAAAT CCGGAAACTC CCCACCCTAA ACACTAAAAC ACATTACAAA AACTGAAAAA
ACACCAACAA GACCACTTAA GCTGCAAGGG CTATCGACCT AGCCAGCAAC ATGTGTGTTT TGTTAATTGG CTCTTTTAAC
TGCATTTTTA TCAAATCAAC TTGGGAGAAT TCATAAGAGA TACATTTAGA CCTCTTGTTT CATCTAGTTG TTGAGCAACT
TTCAATTGAT TGTTTCTGAT TTTGTCATAT CTTCCATCAG GATATGCAAG CTCTTATCAG TAAGATCACC AAGTCAATTG
TGTCGCCATT GCCAACTAGA TATTCTGGTG CATTGTGAGT TTCCATGAGT TAATACTTGA TTGTCTTCTT AATCCATCTT
GTAAATTTAC TTGAGTAATA TCTCTGAAAG CTTTACCATC ATGCAGTAGG GGACTTATTA AGAGCATGCT ACGAAAAAGT
CCAGAACACA GGCCAAGTGT AATTCTCAGT AACTCTCTTA TGTTCATGTC AGTTACTAAT AACATATGTT TATTCTGATA
AGAGTTTTGC ATCATTTTTT TCCCTACAGG CAGCTGAACT ACTCAAGCAT CCACATCTCC AACCCTATGT GCTGCAAGTC
CATTTGAAAT CTTCTCCTGC TCGCAACATA ATTCCTTCCC ATCAGTCTCC GATTGACAAG GTTAAGAAAA TGACATTTCC
CACTGAGTCC ATGTGCAGAA GCAAGGGCAG GAGAAACTCT TTGGGTAATG AGAGAATCGT GACCTTCAGC AAACCTTCTC
CTGAAAGGAA GTTTACTAGT TCTATTCAGA GTATCAAGGA TTACTCAACT ACTCGGAGTG TCAAAGATTT ATCTATCGAT
GTTAGTTTGG TCGAGGAGGT TAGTAGTAAA ACAACTTTTA CCACAAGAAC ATCGAGTATT GTGAAGACTC CCAAGAGAAC
TCCAAGCAAA ACAATCACAA CTCCCCAGTT AGAACCTCCA AAGGTATCTT ACAACAGAGT AAATCGGAGC GAGGTATGAC
ACATTTACCA TGTTTTAAAT GCAGTTTGTA GCACTCTTAT TTACAACCTG TTTATAGCAT GTTCTAATGC ACTTGCACTA
ATTGCCCGGT GCGATGTACT TTTTTTGACG TCCATTTGGT GTTCATCTTT CAAACTGAAC CTTGCGTAAA TATACATAGA
TAGAAGAACA TCCATCAATG AACTGCTAGA TGCATTGTTT CAGTCTGAGC ACGCATTACT GTTCTTACAT TTCATTACTT
CATACACTAA ACCGCTCACT GTAGTTTCCT GAAGAATTTA TTTTCAGTAA TTGAATTCCT ACTTTTTTTC CCATTCTCTA
GCTGCTTTCA AGAACACCGG TGAACAGAAG CGCTCGGGTA ATCCGCAGAG CTTCCCTCCC ACTCCCACTG CCATCATCCG
AGACACCGAA GCGCGGCGTC AGCAGCATCA GCATCCTCGA GCAGCTGGAA TCCCCCGACG TATCCGTGAA TTCGCCTCGG
ATAGACCGGA TCGCCGAGTT CCCGCTGGCC TCATCCGAAG ATCCACCGTT CCTCAAGCTC CACGGACGCC GCTCTCCAAC
TCCAACGCCA CAGCATTGCG TCATCGACCA GTCGATCACC AAGGACAAAT GCATGGTCGA AGCGTTCCAC ATCAtcgacg
tcgatgacga cgacgggagg agcgactcgt cgtcgggccg taacaacgcc gcggcggctg cctcgagccg cgccggctcg
tcggagtcga cgaggcagcg gcgGTTCGAC ACGTCGTCGT ACCAGCAGCG CGCGGAGGCG CTGGAGGGGC TGCTGGAGTT
CAGCGCGCAG CTGCTGCAGC AGGAGAGGTA CGACGAGCTG GGCGTCCTGC TCAAGCCATT CGGCCCGGAG AAGGTGTCCC
CGAGGGAGAC GGCCATCTGG CTCACCAAGA GCTTCAAGGA GACAGGGCTG TAAGCATATG CGATCACTCT CACCTTGCTC
TAGAAAACAA ATGAGCAGAA GCAAATTAAA TTGTAGCTCA GGAAAGATTA GTTGCTGACA GTGTGACACC ATCTCAGTGT
TGCCTCCCCC AACTAGCTTA TGAAAGATTA TTCAGTGATC ATCTATGGAT TAACAAGGAA GTAGCGGTAG TTCTATACTT
CTATGTGGTG TTGGTCTGAA GCAGGAAGTA GTAGTAGTTC ATGTTTCTAA CCATGTAGGA GTACTTGACA GGTAAACTGG
GCATTCCAGC CCGGCTGAAG AATCATCCAG TTGATTGATT TTGTTTCTGT TTGAATAGCA TTTCTCTTGT TCATGTAATC
TTGAGTTATT GAAGGTTTAG AGAGAGAGAG AGAGAGAGCT GCTTGCCTTG TATTATCCAA AGTAGGAATT CAGACAATGG
CCATATCTGA TGGAGACAAC AAGAAGAATT TGAGGAGCTT GTACTGTACT ATGCACAAAG ATAACGTTCT TGTC

Locus: Os03g0636800

Loading...

Locus: Os03g0636800

Loading...