Os03t0641300-01

Locus

Os03g0641300

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK073710 (DDBJ, Best hit)

Protein Evidence

B9FX16 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J033061L21 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0641300-01)

RiceXPro (AK073710)

Others

KEGG (Os03t0641300-01)

Transcript

1526 bp

>Os03t0641300-01 Hypothetical conserved gene.
GATTCCCCCCATTGGAGTGGTTCTTCGTTTGTTTGGAGGAGTGGTTGGATTAGTTGGTGG
CCGGCCGAAAGGAGAGGGCCGTGAATTGGTGAGCCTGCTTCTTCTCTGCTCTGTGGTTCT
TGGAAGAGGCAGAGAGAGAGAGAGAGAGAGCTCTTTTCGATGGCGTCCATGGTTTGAGCT
TCTGGAGCGGTGGTTGGGGGCTTGCGCGGTTGCGGTTGGGGTGTTCTTGCGTGCCATCTC
CTACTTAGGCGGCGGCGGCGGAATCGTTTGAGGTTCAGAGAGATTTCTGCCCGGGATGGC
GTCGTCGGTGAAGCTGGGATCAAAGCCTGATGCTTTCAGAAGGCAAGGGCAGGCATGGTA
AAGCTCTCGCCTTCTTCTTCTTCTTTTTTAATTTACTCACTTCTTTTATTTTTCATCCTT
AGTTTTCTCTGTGTTTTGATGTGTTGTCATGAAAGACTCGCCCTTGTCTGCGTTCTTTGT
TGTTGTTTCGCTATCTGGGACCTGAGAGGGGAGACAAATTGTGTGAAAATTTGGCCAAAA
AAAGGTTCCTTTTTGGCTGCGGATTCATGATATTTTTGGGGGTATGGATGGGTAGAGAGC
TAAGTATTTCTGAAAGTGTGACTCTTCAGAAGTCAACTCGTACTTTGTCTGTGCTGCACG
CCTGCACTCTATGCGCGCTCTTTTCGTGATGCATTTCTTGCATTTGTTTCGTTTTTTGCG
TACTCAGTTCTCTTCTTCAGTCCATTGCAATTACAAGATGCTGTATTAGCACTTGGCAAA
GCTGGTCCAACTAATAGTATTCCACTTGTTGGGAGAAAGTAAAGTTTTGGGCTGAAACCT
GAATTAGTTGTTCATAGGTGAGGTTTTGCAAAAAGTTTGAATTTCAAATAATCAAATTAT
GTAGTTTTTCCCCCTTAAATCAGGTTGTACTTTTCAGTATACCCTATATAACACTAGAGT
TGAATCTTGCATATTTCTCCGTAGTCCGTAGAGAAATAAGTGAGAATTCATCTTTATCAC
CCATTTGGTGCATTATTGCCCACACACTAAATGAATTATGGACATTGAAGCTGGTGGGTT
AATCATTCTTATTCAATCCACAAATATTCCAGTAAATTGCAGTTGACTGCTTGTGCAATT
AGTTTATGGGGAGGGTGTCGTGAAGCTTTTCGTGGATCCACATCACATTAGTTGGCAGTG
AGATGCTGTTGTTCCTCATAACAGAGGAGTTGTAACCATCATGTAATTATTTAGATGGGA
GCAGGTTTGGATTTGTTTTCAGTGGACCAATCAAATATTGTAATTTTCAAACTCAATCAG
CCTCCTTCCAGCCTGTTGAATCTAAGTATTAAATACTCTGATGTGTCTGTTCTAAGAGAG
ATAAGACAGTCATGATGTATTGATGTTATATGTTGTCTTGTGGACAATAAATACTAAATG
ATGTCCCGCGCTTTGCTGCGGGATATatgttagatattggagaaatgatgaaatgatttg
gattgaaatattatgaaaatgattcg

CDS

216 bp

>Os03t0641300-01 Hypothetical conserved gene.
ATGGTAAAGCTCTCGCCTTCTTCTTCTTCTTTTTTAATTTACTCACTTCTTTTATTTTTC
ATCCTTAGTTTTCTCTGTGTTTTGATGTGTTGTCATGAAAGACTCGCCCTTGTCTGCGTT
CTTTGTTGTTGTTTCGCTATCTGGGACCTGAGAGGGGAGACAAATTGTGTGAAAATTTGG
CCAAAAAAAGGTTCCTTTTTGGCTGCGGATTCATGA

Protein

72 aa

>Os03t0641300-01 Hypothetical conserved gene.
MVKLSPSSSSFLIYSLLLFFILSFLCVLMCCHERLALVCVLCCCFAIWDLRGETNCVKIW
PKKGSFLAADS*

5'UTR

chr03:24706180..24706533 (- strand) : 354 bp

CDS

chr03:24705964..24706179 (- strand) : 216 bp

3'UTR

chr03:24705008..24705963 (- strand) : 956 bp

FASTA

>Os03t0641300-01 class=Sequence position=chr03:24705008..24706533 (- strand)
GATTCCCCCC ATTGGAGTGG TTCTTCGTTT GTTTGGAGGA GTGGTTGGAT TAGTTGGTGG CCGGCCGAAA GGAGAGGGCC
GTGAATTGGT GAGCCTGCTT CTTCTCTGCT CTGTGGTTCT TGGAAGAGGC AGAGAGAGAG AGAGAGAGAG CTCTTTTCGA
TGGCGTCCAT GGTTTGAGCT TCTGGAGCGG TGGTTGGGGG CTTGCGCGGT TGCGGTTGGG GTGTTCTTGC GTGCCATCTC
CTACTTAGGC GGCGGCGGCG GAATCGTTTG AGGTTCAGAG AGATTTCTGC CCGGGATGGC GTCGTCGGTG AAGCTGGGAT
CAAAGCCTGA TGCTTTCAGA AGGCAAGGGC AGGCATGGTA AAGCTCTCGC CTTCTTCTTC TTCTTTTTTA ATTTACTCAC
TTCTTTTATT TTTCATCCTT AGTTTTCTCT GTGTTTTGAT GTGTTGTCAT GAAAGACTCG CCCTTGTCTG CGTTCTTTGT
TGTTGTTTCG CTATCTGGGA CCTGAGAGGG GAGACAAATT GTGTGAAAAT TTGGCCAAAA AAAGGTTCCT TTTTGGCTGC
GGATTCATGA TATTTTTGGG GGTATGGATG GGTAGAGAGC TAAGTATTTC TGAAAGTGTG ACTCTTCAGA AGTCAACTCG
TACTTTGTCT GTGCTGCACG CCTGCACTCT ATGCGCGCTC TTTTCGTGAT GCATTTCTTG CATTTGTTTC GTTTTTTGCG
TACTCAGTTC TCTTCTTCAG TCCATTGCAA TTACAAGATG CTGTATTAGC ACTTGGCAAA GCTGGTCCAA CTAATAGTAT
TCCACTTGTT GGGAGAAAGT AAAGTTTTGG GCTGAAACCT GAATTAGTTG TTCATAGGTG AGGTTTTGCA AAAAGTTTGA
ATTTCAAATA ATCAAATTAT GTAGTTTTTC CCCCTTAAAT CAGGTTGTAC TTTTCAGTAT ACCCTATATA ACACTAGAGT
TGAATCTTGC ATATTTCTCC GTAGTCCGTA GAGAAATAAG TGAGAATTCA TCTTTATCAC CCATTTGGTG CATTATTGCC
CACACACTAA ATGAATTATG GACATTGAAG CTGGTGGGTT AATCATTCTT ATTCAATCCA CAAATATTCC AGTAAATTGC
AGTTGACTGC TTGTGCAATT AGTTTATGGG GAGGGTGTCG TGAAGCTTTT CGTGGATCCA CATCACATTA GTTGGCAGTG
AGATGCTGTT GTTCCTCATA ACAGAGGAGT TGTAACCATC ATGTAATTAT TTAGATGGGA GCAGGTTTGG ATTTGTTTTC
AGTGGACCAA TCAAATATTG TAATTTTCAA ACTCAATCAG CCTCCTTCCA GCCTGTTGAA TCTAAGTATT AAATACTCTG
ATGTGTCTGT TCTAAGAGAG ATAAGACAGT CATGATGTAT TGATGTTATA TGTTGTCTTG TGGACAATAA ATACTAAATG
ATGTCCCGCG CTTTGCTGCG GGATATatgt tagatattgg agaaatgatg aaatgatttg gattgaaata ttatgaaaat
gattcg

Locus: Os03g0641300

Loading...

Locus: Os03g0641300

Loading...