Os03t0648400-01

Locus

Os03g0648400

Description

Similar to DnaJ protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA4, YDJ1

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A4, YDJ1 protein

Transcript Evidence

AK103763 (DDBJ, Best hit)

Protein Evidence

NP_001130317.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

Heat shock protein DnaJ, N-terminal (IPR001623)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

J033143G16 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0648400-01)

RiceXPro (AK103763)

Others

Oryzabase (12141)

KEGG (Os03t0648400-01)

Transcript

893 bp

>Os03t0648400-01 Similar to DnaJ protein.
CTCTTTCTCTCCTCCCACTCCGCTAGCTCCGGCCACCAACTTTGACCCGTCCTCCTCCTC
CGCATCCCCCATCCCCTCCTCCCCGGCGGCGGCGGCGGCGCGGAGGCGGCGGCACGGGAG
CGGCTAGTGGTTTCGTCGGCGGAGGCGGAGGCGGGGCCAAGATGTTCGGGCGCGCGCCGA
AGAAGAGCGACAACACCAAGTACTACGAGATCCTGGGGGTCCCCAAGACCGCCTCCCAGG
ACGACCTCAAGAAGGCGTACCGCAAGGCCGCCATCAAGAACCACCCCGACAAGGGCGGCG
ACCCCGAGAAGTTCAAGGAGCTTGCACAAGCTTATGAGGTATTGAGTGACCCGGAGAAAC
GTGAAATCTATGACCAATATGGTGAAGATGCCCTCAAGGAAGGAATGGGTGGAGGCGGAT
CCCATGttgatccatttgacatcttttcatcattctttggaccttcttttggtgGTGGTG
GCAGCAGCAGGGGCAGAAGGCAAAGGAGGGGAGAGGATGTGATCCATCCGCTTAAGGTTT
CTCTAGAAGATCTTTACAATGGTACTTCAAAGAAGCTCTCTCTTTCCCGCAATGTCCTCT
GCGCCAAGTGCAAGGGCAAGGGTTCCAAGTCTGGTGCTTCCATGAGGTGCCCAGGTTGCC
AGGGGTCTGGCATGAAAATCACCATCCGCCAGCTGGGGCCTTCCATGATACAGCAGATGC
AGCAGCCTTGCAATGAGTGTAAGGGGACTGGAGAGAGCATTAATGAGAAGGATCGCTGCC
CAGGCTGCAAGGGCGAGAAGGTTATTCAGGAGAAGAAGGTTCTGGAGGTTCACGTTGAGA
AGGGGATGCAACACAATCAGAAGATCACTTTCCCTGGTGAAGCTGATGAGGCG

CDS

732 bp

>Os03t0648400-01 Similar to DnaJ protein.
ATGTTCGGGCGCGCGCCGAAGAAGAGCGACAACACCAAGTACTACGAGATCCTGGGGGTC
CCCAAGACCGCCTCCCAGGACGACCTCAAGAAGGCGTACCGCAAGGCCGCCATCAAGAAC
CACCCCGACAAGGGCGGCGACCCCGAGAAGTTCAAGGAGCTTGCACAAGCTTATGAGGTA
TTGAGTGACCCGGAGAAACGTGAAATCTATGACCAATATGGTGAAGATGCCCTCAAGGAA
GGAATGGGTGGAGGCGGATCCCATGttgatccatttgacatcttttcatcattctttgga
ccttcttttggtgGTGGTGGCAGCAGCAGGGGCAGAAGGCAAAGGAGGGGAGAGGATGTG
ATCCATCCGCTTAAGGTTTCTCTAGAAGATCTTTACAATGGTACTTCAAAGAAGCTCTCT
CTTTCCCGCAATGTCCTCTGCGCCAAGTGCAAGGGCAAGGGTTCCAAGTCTGGTGCTTCC
ATGAGGTGCCCAGGTTGCCAGGGGTCTGGCATGAAAATCACCATCCGCCAGCTGGGGCCT
TCCATGATACAGCAGATGCAGCAGCCTTGCAATGAGTGTAAGGGGACTGGAGAGAGCATT
AATGAGAAGGATCGCTGCCCAGGCTGCAAGGGCGAGAAGGTTATTCAGGAGAAGAAGGTT
CTGGAGGTTCACGTTGAGAAGGGGATGCAACACAATCAGAAGATCACTTTCCCTGGTGAA
GCTGATGAGGCG

Protein

244 aa

>Os03t0648400-01 Similar to DnaJ protein.
MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDIFSSFFGPSFGGGGSSRGRRQRRGEDV
IHPLKVSLEDLYNGTSKKLSLSRNVLCAKCKGKGSKSGASMRCPGCQGSGMKITIRQLGP
SMIQQMQQPCNECKGTGESINEKDRCPGCKGEKVIQEKKVLEVHVEKGMQHNQKITFPGE
ADEA

5'UTR

chr03:25127262..25127422 (+ strand) : 161 bp

CDS

chr03:25127423..25127572 (+ strand) : 150 bp

chr03:25129124..25129286 (+ strand) : 163 bp

chr03:25129393..25129534 (+ strand) : 142 bp

chr03:25129615..25129891 (+ strand) : 277 bp

FASTA

>Os03t0648400-01 class=Sequence position=chr03:25127262..25129891 (+ strand)
CTCTTTCTCT CCTCCCACTC CGCTAGCTCC GGCCACCAAC TTTGACCCGT CCTCCTCCTC CGCATCCCCC ATCCCCTCCT
CCCCGGCGGC GGCGGCGGCG CGGAGGCGGC GGCACGGGAG CGGCTAGTGG TTTCGTCGGC GGAGGCGGAG GCGGGGCCAA
GATGTTCGGG CGCGCGCCGA AGAAGAGCGA CAACACCAAG TACTACGAGA TCCTGGGGGT CCCCAAGACC GCCTCCCAGG
ACGACCTCAA GAAGGCGTAC CGCAAGGCCG CCATCAAGAA CCACCCCGAC AAGGGCGGCG ACCCCGAGAA GGTCCGAGCC
CGATCCCGAT CCCCCACCCT CCTCCTCCGT TCTACCGGAT CTCAGGGCCG CTTGCTCCCT TTCTCGATCC GACGCGATCT
GGTTCGATCC CGTCCCGTCG CGGATGATGG ATCGGGGGGC GGGCGGAACA TCATCTCGTT TTGTTACTTT AGGCCTGGTA
GGATTTGCAG TCTGCGGTTC ATGTGGGGGG AATTTGGGCG GCGAGCGGGC GGGCGATCAA AGATTTGCTC GGTTTTACTT
GTTGCTGAGG GGGTGGGTTA GTGTGAATTG TGAATTTGTG ATGCGATCAT GGCCATGATC TTGGGGGTTT GTGGGGGGAA
CAATAGACTG GATTCGTAAC ATCAAGTAGA CTGTGCAGAT TCTTCTGCTA CAATAGAACC AATAGAGGAG ACCACTGAAA
CAGCGATCCG TGCGATCTTT AAGTGCTTTC AGAATTCAGA TGTTCGTTTT CCCAAGTTTT ATGCGCTAGT TACTTCCCAA
GAATTTTCCG CTGCGCTTGA GGTTTGCTGG ATCATTTTTA ATTTGCGTTG TGGTTATCTA TCAAGATCAT TAGCTAGCTG
AAATGGACTT ACAAAGTCTG TTTGTGTTCA GATAGTATTC ATTTTCAGAG AACCATCTAG CTCATTGCTG GGTTGTAATC
TTATACTGAC ACCGTAAGAT ATTTCATTGT TCTCATTCTG CCATACCTCA GCGAAGCATC TATAGCTGTG AAATGCCCCA
TTGAATCTAG CTCATTGCTG GGTTGTATTG TTATACTGAC CCTGTAAGAT ATTTCGTTGT TCTCATTCTG CCTCAGCGAA
GCATCTTTAG CTGTGAAATG CTCCATTGAT TGCATCTTTA ATTCTCGCAT CGGATAACAT CTTGAGTAAC GGCTGTACTG
GAATGTTTAA AACTGGTAGC ATTAGGGCAT TGTTCTTCAG GCAAAGTATC CTTTGGTGAT CATAGGACTA CTCATTCTAG
CTGTGATTCA AATCCACTTG CTAATTAATT GTTTAGGAAA AGCGCTTGTT TGGGTAGTCC GGTAATGTGA CTTTCAATTA
AATGTTTCTA TATGTTGGGA GTATTTTGTC TGTTTAAATC CTATTAGATT TTGCTCTGCC CCTTTATGTT TAGCACTGTA
TCTTACATGA TGAAATATTG TTTTTAATTC TTATGCTCCT TATCATAATA CTTCTGAGTT CGAtacttcc tccgtttcac
aatgtaagag tttctagcat tgcccgcatt catttagatg ttaatgaacc tagacatgtg tatgtgttta gattcattaa
catctatatg aatgtgggca atgctagaaa gacttacatt gtgaaacgga gggagtaTAA ATTTTGTTAC TGCATATTGG
AGTCAACAAA TGCTTATTGT CTTATTGAAT GCGACATGGA ATGGCGAATA TAGCATATAT CCATATAGTG ATCACAACTA
TATTTCCTTT TGTTTACTGC TTTTTCAGTC ATCCATGTAT TCATAATCTG TAGAATGAAA GAGGCTAATT TTAGGCATAT
CTTTGTTTTA ATTTTATCTC AGTTCAAGGA GCTTGCACAA GCTTATGAGG TATTGAGTGA CCCGGAGAAA CGTGAAATCT
ATGACCAATA TGGTGAAGAT GCCCTCAAGG AAGGAATGGG TGGAGGCGGA TCCCATGttg atccatttga catcttttca
tcattctttg gaccttcttt tggtggtatt ttttgaagac aatacatttt cctGTGTGAT TGTGTTGAAC TCTGTTAATC
TCTTGTTTTG TTGATGTAAT GAAATTTCGT TTGTTTATGT TTTGAGCACA GGTGGTGGCA GCAGCAGGGG CAGAAGGCAA
AGGAGGGGAG AGGATGTGAT CCATCCGCTT AAGGTTTCTC TAGAAGATCT TTACAATGGT ACTTCAAAGA AGCTCTCTCT
TTCCCGCAAT GTCCTCTGCG CCAAGTGCAA GGGGTAAGTC TGGTTTGCCC TAGCATAGTA AACTATGCAT TTTCACAATC
CTGCTCTTGA ACATTACTCC CTGTTCATTT CAGCAAGGGT TCCAAGTCTG GTGCTTCCAT GAGGTGCCCA GGTTGCCAGG
GGTCTGGCAT GAAAATCACC ATCCGCCAGC TGGGGCCTTC CATGATACAG CAGATGCAGC AGCCTTGCAA TGAGTGTAAG
GGGACTGGAG AGAGCATTAA TGAGAAGGAT CGCTGCCCAG GCTGCAAGGG CGAGAAGGTT ATTCAGGAGA AGAAGGTTCT
GGAGGTTCAC GTTGAGAAGG GGATGCAACA CAATCAGAAG ATCACTTTCC CTGGTGAAGC TGATGAGGCG 

Locus: Os03g0648400

Loading...

Locus: Os03g0648400

Loading...