Os03t0648400-02

Locus

Os03g0648400

Description

Similar to DnaJ protein homolog (DNAJ-1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA4, YDJ1

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A4, YDJ1 protein

Transcript Evidence

AK102263 (DDBJ, Best hit)

Protein Evidence

NP_001130317.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: response to heat (GO:0009408)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

Heat shock protein DnaJ, N-terminal (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Chaperone DnaJ (IPR012724)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

J033088M01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0648400-02)

RiceXPro (AK102263)

Others

Oryzabase (12141)

KEGG (Os03t0648400-02)

Transcript

1817 bp

>Os03t0648400-02 Similar to DnaJ protein homolog (DNAJ-1).
TCTTTCTCTCCTCCCACTCCGCTAGCTCCGGCCACCAACTTTGACCCGTCCTCCTCCTCC
GCATCCCCCATCCCCTCCTCCCCGGCGGCGGCGGCGGCGCGGAGGCGGCGGCACGGGAGC
GGCTAGTGGTTTCGTCGGCGGAGGCGGAGGCGGGGCCAAGATGTTCGGGCGCGCGCCGAA
GAAGAGCGACAACACCAAGTACTACGAGATCCTGGGGGTCCCCAAGACCGCCTCCCAGGA
CGACCTCAAGAAGGCGTACCGCAAGGCCGCCATCAAGAACCACCCCGACAAGGGCGGCGA
CCCCGAGAAGTTCAAGGAGCTTGCACAAGCTTATGAGGTATTGAGTGACCCGGAGAAACG
TGAAATCTATGACCAATATGGTGAAGATGCCCTCAAGGAAGGAATGGGTGGAGGCGGATC
CCATGttgatccatttgacatcttttcatcattctttggaccttcttttggtgGTGGTGG
CAGCAGCAGGGGCAGAAGGCAAAGGAGGGGAGAGGATGTGATCCATCCGCTTAAGGTTTC
TCTAGAAGATCTTTACAATGGTACTTCAAAGAAGCTCTCTCTTTCCCGCAATGTCCTCTG
CGCCAAGTGCAAGGGCAAGGGTTCCAAGTCTGGTGCTTCCATGAGGTGCCCAGGTTGCCA
GGGGTCTGGCATGAAAATCACCATCCGCCAGCTGGGGCCTTCCATGATACAGCAGATGCA
GCAGCCTTGCAATGAGTGTAAGGGGACTGGAGAGAGCATTAATGAGAAGGATCGCTGCCC
AGGCTGCAAGGGCGAGAAGGTTATTCAGGAGAAGAAGGTTCTGGAGGTTCACGTTGAGAA
GGGGATGCAACACAATCAGAAGATCACTTTCCCTGGTGAAGCTGATGAGGCGCCTGATAC
CGTTACGGGAGACATTGTATTCGTCCTCCAGCAGAAGGACCACTCCAAGTTCAAAAGGAA
GGGCGATGATCTCTTTTATGAGCACACCTTATCTCTGACTGAAGCACTTTGTGGTTTCCA
ATTTGTCCTGACACATCTGGACAACAGACAGCTGCTCATTAAGTCAAACCCCGGTGAAGT
TGTTAAGCCTGACCAATTCAAGGCAATAAACGATGAGGGAATGCCAATGTACCAGAGGCC
TTTCATGAAGGGGAAGCTCTACATTCATTTCACGGTGGAGTTCCCTGATTCCCTGGCGCC
TGAACAATGCAAGGCTCTCGAGGCTGTGCTTCCACCGAAGCCTGCATCCCAGCTGACAGA
AATGGAGATAGATGAATGCGAGGAGACCACGATGCACGatgtcaacaacattgaggaaga
gatgcgcaggaaagcccaagctgctcaggaggcgtatgatgaggacgatgagatgcctgg
aggtgcccagagagttcagtgcgCGCAACAGTAAGCAGAGTATGTCATCTAGGAAACTCG
TCATTGGTTCACAAATCAACGTCGTCGCAAAGGTTTGCCGTAAATTTTTGGACCCAAAGA
TGATTGTGCTCTGTTTCCCGTTGCGGCGAACATGAAGATAGTGAAGCTGATTTTACACCC
CTTAAGCCGGGACTGTATCCCTTTTGTTTGCGACTTAAAAAATGCTACTCGTATCTAGTA
ATAGCTGGCTACGTTTTACTATGCTGTGAGACTCGTAGAGTTTTACCTCCTAAAAAGAAA
CTCGGTATGTTGTGAATGCTACAACTGACACTGCACCGTGTGCAGTGGCTCAACATTTTT
TGTGGTCAGATGGCTATGCTTGCACCGTGAGACTCGTAGAGTTGTGCATCTAAATATGCA
TTTCTTCCTTTGCTGTT

CDS

1254 bp

>Os03t0648400-02 Similar to DnaJ protein homolog (DNAJ-1).
ATGTTCGGGCGCGCGCCGAAGAAGAGCGACAACACCAAGTACTACGAGATCCTGGGGGTC
CCCAAGACCGCCTCCCAGGACGACCTCAAGAAGGCGTACCGCAAGGCCGCCATCAAGAAC
CACCCCGACAAGGGCGGCGACCCCGAGAAGTTCAAGGAGCTTGCACAAGCTTATGAGGTA
TTGAGTGACCCGGAGAAACGTGAAATCTATGACCAATATGGTGAAGATGCCCTCAAGGAA
GGAATGGGTGGAGGCGGATCCCATGttgatccatttgacatcttttcatcattctttgga
ccttcttttggtgGTGGTGGCAGCAGCAGGGGCAGAAGGCAAAGGAGGGGAGAGGATGTG
ATCCATCCGCTTAAGGTTTCTCTAGAAGATCTTTACAATGGTACTTCAAAGAAGCTCTCT
CTTTCCCGCAATGTCCTCTGCGCCAAGTGCAAGGGCAAGGGTTCCAAGTCTGGTGCTTCC
ATGAGGTGCCCAGGTTGCCAGGGGTCTGGCATGAAAATCACCATCCGCCAGCTGGGGCCT
TCCATGATACAGCAGATGCAGCAGCCTTGCAATGAGTGTAAGGGGACTGGAGAGAGCATT
AATGAGAAGGATCGCTGCCCAGGCTGCAAGGGCGAGAAGGTTATTCAGGAGAAGAAGGTT
CTGGAGGTTCACGTTGAGAAGGGGATGCAACACAATCAGAAGATCACTTTCCCTGGTGAA
GCTGATGAGGCGCCTGATACCGTTACGGGAGACATTGTATTCGTCCTCCAGCAGAAGGAC
CACTCCAAGTTCAAAAGGAAGGGCGATGATCTCTTTTATGAGCACACCTTATCTCTGACT
GAAGCACTTTGTGGTTTCCAATTTGTCCTGACACATCTGGACAACAGACAGCTGCTCATT
AAGTCAAACCCCGGTGAAGTTGTTAAGCCTGACCAATTCAAGGCAATAAACGATGAGGGA
ATGCCAATGTACCAGAGGCCTTTCATGAAGGGGAAGCTCTACATTCATTTCACGGTGGAG
TTCCCTGATTCCCTGGCGCCTGAACAATGCAAGGCTCTCGAGGCTGTGCTTCCACCGAAG
CCTGCATCCCAGCTGACAGAAATGGAGATAGATGAATGCGAGGAGACCACGATGCACGat
gtcaacaacattgaggaagagatgcgcaggaaagcccaagctgctcaggaggcgtatgat
gaggacgatgagatgcctggaggtgcccagagagttcagtgcgCGCAACAGTAA

Protein

418 aa

>Os03t0648400-02 Similar to DnaJ protein homolog (DNAJ-1).
MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDIFSSFFGPSFGGGGSSRGRRQRRGEDV
IHPLKVSLEDLYNGTSKKLSLSRNVLCAKCKGKGSKSGASMRCPGCQGSGMKITIRQLGP
SMIQQMQQPCNECKGTGESINEKDRCPGCKGEKVIQEKKVLEVHVEKGMQHNQKITFPGE
ADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQLLI
KSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVLPPK
PASQLTEMEIDECEETTMHDVNNIEEEMRRKAQAAQEAYDEDDEMPGGAQRVQCAQQ*

5'UTR

chr03:25127263..25127422 (+ strand) : 160 bp

CDS

chr03:25127423..25127572 (+ strand) : 150 bp

chr03:25129124..25129286 (+ strand) : 163 bp

chr03:25129393..25129534 (+ strand) : 142 bp

chr03:25129615..25129891 (+ strand) : 277 bp

chr03:25129974..25130172 (+ strand) : 199 bp

chr03:25130256..25130578 (+ strand) : 323 bp

3'UTR

chr03:25130579..25130981 (+ strand) : 403 bp

FASTA

>Os03t0648400-02 class=Sequence position=chr03:25127263..25130981 (+ strand)
TCTTTCTCTC CTCCCACTCC GCTAGCTCCG GCCACCAACT TTGACCCGTC CTCCTCCTCC GCATCCCCCA TCCCCTCCTC
CCCGGCGGCG GCGGCGGCGC GGAGGCGGCG GCACGGGAGC GGCTAGTGGT TTCGTCGGCG GAGGCGGAGG CGGGGCCAAG
ATGTTCGGGC GCGCGCCGAA GAAGAGCGAC AACACCAAGT ACTACGAGAT CCTGGGGGTC CCCAAGACCG CCTCCCAGGA
CGACCTCAAG AAGGCGTACC GCAAGGCCGC CATCAAGAAC CACCCCGACA AGGGCGGCGA CCCCGAGAAG GTCCGAGCCC
GATCCCGATC CCCCACCCTC CTCCTCCGTT CTACCGGATC TCAGGGCCGC TTGCTCCCTT TCTCGATCCG ACGCGATCTG
GTTCGATCCC GTCCCGTCGC GGATGATGGA TCGGGGGGCG GGCGGAACAT CATCTCGTTT TGTTACTTTA GGCCTGGTAG
GATTTGCAGT CTGCGGTTCA TGTGGGGGGA ATTTGGGCGG CGAGCGGGCG GGCGATCAAA GATTTGCTCG GTTTTACTTG
TTGCTGAGGG GGTGGGTTAG TGTGAATTGT GAATTTGTGA TGCGATCATG GCCATGATCT TGGGGGTTTG TGGGGGGAAC
AATAGACTGG ATTCGTAACA TCAAGTAGAC TGTGCAGATT CTTCTGCTAC AATAGAACCA ATAGAGGAGA CCACTGAAAC
AGCGATCCGT GCGATCTTTA AGTGCTTTCA GAATTCAGAT GTTCGTTTTC CCAAGTTTTA TGCGCTAGTT ACTTCCCAAG
AATTTTCCGC TGCGCTTGAG GTTTGCTGGA TCATTTTTAA TTTGCGTTGT GGTTATCTAT CAAGATCATT AGCTAGCTGA
AATGGACTTA CAAAGTCTGT TTGTGTTCAG ATAGTATTCA TTTTCAGAGA ACCATCTAGC TCATTGCTGG GTTGTAATCT
TATACTGACA CCGTAAGATA TTTCATTGTT CTCATTCTGC CATACCTCAG CGAAGCATCT ATAGCTGTGA AATGCCCCAT
TGAATCTAGC TCATTGCTGG GTTGTATTGT TATACTGACC CTGTAAGATA TTTCGTTGTT CTCATTCTGC CTCAGCGAAG
CATCTTTAGC TGTGAAATGC TCCATTGATT GCATCTTTAA TTCTCGCATC GGATAACATC TTGAGTAACG GCTGTACTGG
AATGTTTAAA ACTGGTAGCA TTAGGGCATT GTTCTTCAGG CAAAGTATCC TTTGGTGATC ATAGGACTAC TCATTCTAGC
TGTGATTCAA ATCCACTTGC TAATTAATTG TTTAGGAAAA GCGCTTGTTT GGGTAGTCCG GTAATGTGAC TTTCAATTAA
ATGTTTCTAT ATGTTGGGAG TATTTTGTCT GTTTAAATCC TATTAGATTT TGCTCTGCCC CTTTATGTTT AGCACTGTAT
CTTACATGAT GAAATATTGT TTTTAATTCT TATGCTCCTT ATCATAATAC TTCTGAGTTC GAtacttcct ccgtttcaca
atgtaagagt ttctagcatt gcccgcattc atttagatgt taatgaacct agacatgtgt atgtgtttag attcattaac
atctatatga atgtgggcaa tgctagaaag acttacattg tgaaacggag ggagtaTAAA TTTTGTTACT GCATATTGGA
GTCAACAAAT GCTTATTGTC TTATTGAATG CGACATGGAA TGGCGAATAT AGCATATATC CATATAGTGA TCACAACTAT
ATTTCCTTTT GTTTACTGCT TTTTCAGTCA TCCATGTATT CATAATCTGT AGAATGAAAG AGGCTAATTT TAGGCATATC
TTTGTTTTAA TTTTATCTCA GTTCAAGGAG CTTGCACAAG CTTATGAGGT ATTGAGTGAC CCGGAGAAAC GTGAAATCTA
TGACCAATAT GGTGAAGATG CCCTCAAGGA AGGAATGGGT GGAGGCGGAT CCCATGttga tccatttgac atcttttcat
cattctttgg accttctttt ggtggtattt tttgaagaca atacattttc ctGTGTGATT GTGTTGAACT CTGTTAATCT
CTTGTTTTGT TGATGTAATG AAATTTCGTT TGTTTATGTT TTGAGCACAG GTGGTGGCAG CAGCAGGGGC AGAAGGCAAA
GGAGGGGAGA GGATGTGATC CATCCGCTTA AGGTTTCTCT AGAAGATCTT TACAATGGTA CTTCAAAGAA GCTCTCTCTT
TCCCGCAATG TCCTCTGCGC CAAGTGCAAG GGGTAAGTCT GGTTTGCCCT AGCATAGTAA ACTATGCATT TTCACAATCC
TGCTCTTGAA CATTACTCCC TGTTCATTTC AGCAAGGGTT CCAAGTCTGG TGCTTCCATG AGGTGCCCAG GTTGCCAGGG
GTCTGGCATG AAAATCACCA TCCGCCAGCT GGGGCCTTCC ATGATACAGC AGATGCAGCA GCCTTGCAAT GAGTGTAAGG
GGACTGGAGA GAGCATTAAT GAGAAGGATC GCTGCCCAGG CTGCAAGGGC GAGAAGGTTA TTCAGGAGAA GAAGGTTCTG
GAGGTTCACG TTGAGAAGGG GATGCAACAC AATCAGAAGA TCACTTTCCC TGGTGAAGCT GATGAGGCGG TATGATTGTT
TCATCTATTA GGGTAGTTTC TATAGATTGA CTCAATGACC AGAACTATAT TGAAGAATGT TTTACTTGCA GCCTGATACC
GTTACGGGAG ACATTGTATT CGTCCTCCAG CAGAAGGACC ACTCCAAGTT CAAAAGGAAG GGCGATGATC TCTTTTATGA
GCACACCTTA TCTCTGACTG AAGCACTTTG TGGTTTCCAA TTTGTCCTGA CACATCTGGA CAACAGACAG CTGCTCATTA
AGTCAAACCC CGGTGAAGTT GTTAAGCCTG GTAAGACCTT GTAGATGTTA AGAGCAATGT AGTATTTATG CAACTGTACT
TGTCGGTAAT CCTTGTCTCA TATATTTGAG CAGACCAATT CAAGGCAATA AACGATGAGG GAATGCCAAT GTACCAGAGG
CCTTTCATGA AGGGGAAGCT CTACATTCAT TTCACGGTGG AGTTCCCTGA TTCCCTGGCG CCTGAACAAT GCAAGGCTCT
CGAGGCTGTG CTTCCACCGA AGCCTGCATC CCAGCTGACA GAAATGGAGA TAGATGAATG CGAGGAGACC ACGATGCACG
atgtcaacaa cattgaggaa gagatgcgca ggaaagccca agctgctcag gaggcgtatg atgaggacga tgagatgcct
ggaggtgccc agagagttca gtgcgCGCAA CAGTAAGCAG AGTATGTCAT CTAGGAAACT CGTCATTGGT TCACAAATCA
ACGTCGTCGC AAAGGTTTGC CGTAAATTTT TGGACCCAAA GATGATTGTG CTCTGTTTCC CGTTGCGGCG AACATGAAGA
TAGTGAAGCT GATTTTACAC CCCTTAAGCC GGGACTGTAT CCCTTTTGTT TGCGACTTAA AAAATGCTAC TCGTATCTAG
TAATAGCTGG CTACGTTTTA CTATGCTGTG AGACTCGTAG AGTTTTACCT CCTAAAAAGA AACTCGGTAT GTTGTGAATG
CTACAACTGA CACTGCACCG TGTGCAGTGG CTCAACATTT TTTGTGGTCA GATGGCTATG CTTGCACCGT GAGACTCGTA
GAGTTGTGCA TCTAAATATG CATTTCTTCC TTTGCTGTT

Locus: Os03g0648400

Loading...

Locus: Os03g0648400

Loading...