Os03t0648400-03

Locus

Os03g0648400

Description

Similar to DnaJ protein homolog (DNAJ-1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA4, YDJ1

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A4, YDJ1 protein

Transcript Evidence

AK105028 (DDBJ, Best hit)

Protein Evidence

NP_001130317.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: response to heat (GO:0009408)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

Heat shock protein DnaJ, N-terminal (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Chaperone DnaJ (IPR012724)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

001-012-E01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0648400-03)

RiceXPro (AK105028)

Others

Oryzabase (12141)

KEGG (Os03t0648400-03)

Transcript

1666 bp

>Os03t0648400-03 Similar to DnaJ protein homolog (DNAJ-1).
ACCAACTTTGACCCGTCCTCCTCCTCCGCATCCCCCATCCCCTCCTCCCCGGCGGCGGCG
GCGGCGCGGAGGCGGCGGCACGGGAGCGGCTAGTGGTTTCGTCGGCGGAGGCGGAGGCGG
GGCCAAGATGTTCGGGCGCGCGCCGAAGAAGAGCGACAACACCAAGTACTACGAGATCCT
GGGGGTCCCCAAGACCGCCTCCCAGGACGACCTCAAGAAGGCGTACCGCAAGGCCGCCAT
CAAGAACCACCCCGACAAGGGCGGCGACCCCGAGAAGTTCAAGGAGCTTGCACAAGCTTA
TGAGGTATTGAGTGACCCGGAGAAACGTGAAATCTATGACCAATATGGTGAAGATGCCCT
CAAGGAAGGAATGGGTGGAGGCGGATCCCATGttgatccatttgacatcttttcatcatt
ctttggaccttcttttggtgGTGGTGGCAGCAGCAGGGGCAGAAGGCAAAGGAGGGGAGA
GGATGTGATCCATCCGCTTAAGGTTTCTCTAGAAGATCTTTACAATGGTACTTCAAAGAA
GCTCTCTCTTTCCCGCAATGTCCTCTGCGCCAAGTGCAAGGGCAAGGGTTCCAAGTCTGG
TGCTTCCATGAGGTGCCCAGGTTGCCAGGGGTCTGGCATGAAAATCACCATCCGCCAGCT
GGGGCCTTCCATGATACAGCAGATGCAGCAGCCTTGCAATGAGTGTAAGGGGACTGGAGA
GAGCATTAATGAGAAGGATCGCTGCCCAGGCTGCAAGGGCGAGAAGGTTATTCAGGAGAA
GAAGGTTCTGGAGGTTCACGTTGAGAAGGGGATGCAACACAATCAGAAGATCACTTTCCC
TGGTGAAGCTGATGAGGCGCCTGATACCGTTACGGGAGACATTGTATTCGTCCTCCAGCA
GAAGGACCACTCCAAGTTCAAAAGGAAGGGCGATGATCTCTTTTATGAGCACACCTTATC
TCTGACTGAAGCACTTTGTGGTTTCCAATTTGTCCTGACACATCTGGACAACAGACAGCT
GCTCATTAAGTCAAACCCCGGTGAAGTTGTTAAGCCTGACCAATTCAAGGCAATAAACGA
TGAGGGAATGCCAATGTACCAGAGGCCTTTCATGAAGGGGAAGCTCTACATTCATTTCAC
GGTGGAGTTCCCTGATTCCCTGGCGCCTGAACAATGCAAGGCTCTCGAGGCTGTGCTTCC
ACCGAAGCCTGCATCCCAGCTGACAGAAATGGAGATAGATGAATGCGAGGAGACCACGAT
GCACGatgtcaacaacattgaggaagagatgcgcaggaaagcccaagctgctcaggaggc
gtatgatgaggacgatgagatgcctggaggtgcccagagagttcagtgcgCGCAACAGTA
AGCAGAGTATGTCATCTAGGAAACTCGTCATTGGTTCACAAATCAACGTCGTCGCAAAGG
TTTGCCGTAAATTTTTGGACCCAAAGATGATTGTGCTCTGTTTCCCGTTGCGGCGAACAT
GAAGATAGTGAAGCTGATTTTACACCCCTTAAGCCGGGACTGTATCCCTTTTGTTTGCGA
CTTAAAAAATGCTACTCGTATCTAGTAATAGCTGGCTACGTTTTACTATGCTGTGAGACT
CGTAGAGTTTTACCTCCTAAAAAGAAACTCGGTATGTTGTGAATGC

CDS

1254 bp

>Os03t0648400-03 Similar to DnaJ protein homolog (DNAJ-1).
ATGTTCGGGCGCGCGCCGAAGAAGAGCGACAACACCAAGTACTACGAGATCCTGGGGGTC
CCCAAGACCGCCTCCCAGGACGACCTCAAGAAGGCGTACCGCAAGGCCGCCATCAAGAAC
CACCCCGACAAGGGCGGCGACCCCGAGAAGTTCAAGGAGCTTGCACAAGCTTATGAGGTA
TTGAGTGACCCGGAGAAACGTGAAATCTATGACCAATATGGTGAAGATGCCCTCAAGGAA
GGAATGGGTGGAGGCGGATCCCATGttgatccatttgacatcttttcatcattctttgga
ccttcttttggtgGTGGTGGCAGCAGCAGGGGCAGAAGGCAAAGGAGGGGAGAGGATGTG
ATCCATCCGCTTAAGGTTTCTCTAGAAGATCTTTACAATGGTACTTCAAAGAAGCTCTCT
CTTTCCCGCAATGTCCTCTGCGCCAAGTGCAAGGGCAAGGGTTCCAAGTCTGGTGCTTCC
ATGAGGTGCCCAGGTTGCCAGGGGTCTGGCATGAAAATCACCATCCGCCAGCTGGGGCCT
TCCATGATACAGCAGATGCAGCAGCCTTGCAATGAGTGTAAGGGGACTGGAGAGAGCATT
AATGAGAAGGATCGCTGCCCAGGCTGCAAGGGCGAGAAGGTTATTCAGGAGAAGAAGGTT
CTGGAGGTTCACGTTGAGAAGGGGATGCAACACAATCAGAAGATCACTTTCCCTGGTGAA
GCTGATGAGGCGCCTGATACCGTTACGGGAGACATTGTATTCGTCCTCCAGCAGAAGGAC
CACTCCAAGTTCAAAAGGAAGGGCGATGATCTCTTTTATGAGCACACCTTATCTCTGACT
GAAGCACTTTGTGGTTTCCAATTTGTCCTGACACATCTGGACAACAGACAGCTGCTCATT
AAGTCAAACCCCGGTGAAGTTGTTAAGCCTGACCAATTCAAGGCAATAAACGATGAGGGA
ATGCCAATGTACCAGAGGCCTTTCATGAAGGGGAAGCTCTACATTCATTTCACGGTGGAG
TTCCCTGATTCCCTGGCGCCTGAACAATGCAAGGCTCTCGAGGCTGTGCTTCCACCGAAG
CCTGCATCCCAGCTGACAGAAATGGAGATAGATGAATGCGAGGAGACCACGATGCACGat
gtcaacaacattgaggaagagatgcgcaggaaagcccaagctgctcaggaggcgtatgat
gaggacgatgagatgcctggaggtgcccagagagttcagtgcgCGCAACAGTAA

Protein

418 aa

>Os03t0648400-03 Similar to DnaJ protein homolog (DNAJ-1).
MFGRAPKKSDNTKYYEILGVPKTASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEV
LSDPEKREIYDQYGEDALKEGMGGGGSHVDPFDIFSSFFGPSFGGGGSSRGRRQRRGEDV
IHPLKVSLEDLYNGTSKKLSLSRNVLCAKCKGKGSKSGASMRCPGCQGSGMKITIRQLGP
SMIQQMQQPCNECKGTGESINEKDRCPGCKGEKVIQEKKVLEVHVEKGMQHNQKITFPGE
ADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALCGFQFVLTHLDNRQLLI
KSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDSLAPEQCKALEAVLPPK
PASQLTEMEIDECEETTMHDVNNIEEEMRRKAQAAQEAYDEDDEMPGGAQRVQCAQQ*

5'UTR

chr03:25127296..25127422 (+ strand) : 127 bp

CDS

chr03:25127423..25127572 (+ strand) : 150 bp

chr03:25129124..25129286 (+ strand) : 163 bp

chr03:25129393..25129534 (+ strand) : 142 bp

chr03:25129615..25129891 (+ strand) : 277 bp

chr03:25129974..25130172 (+ strand) : 199 bp

chr03:25130256..25130578 (+ strand) : 323 bp

3'UTR

chr03:25130579..25130863 (+ strand) : 285 bp

FASTA

>Os03t0648400-03 class=Sequence position=chr03:25127296..25130863 (+ strand)
ACCAACTTTG ACCCGTCCTC CTCCTCCGCA TCCCCCATCC CCTCCTCCCC GGCGGCGGCG GCGGCGCGGA GGCGGCGGCA
CGGGAGCGGC TAGTGGTTTC GTCGGCGGAG GCGGAGGCGG GGCCAAGATG TTCGGGCGCG CGCCGAAGAA GAGCGACAAC
ACCAAGTACT ACGAGATCCT GGGGGTCCCC AAGACCGCCT CCCAGGACGA CCTCAAGAAG GCGTACCGCA AGGCCGCCAT
CAAGAACCAC CCCGACAAGG GCGGCGACCC CGAGAAGGTC CGAGCCCGAT CCCGATCCCC CACCCTCCTC CTCCGTTCTA
CCGGATCTCA GGGCCGCTTG CTCCCTTTCT CGATCCGACG CGATCTGGTT CGATCCCGTC CCGTCGCGGA TGATGGATCG
GGGGGCGGGC GGAACATCAT CTCGTTTTGT TACTTTAGGC CTGGTAGGAT TTGCAGTCTG CGGTTCATGT GGGGGGAATT
TGGGCGGCGA GCGGGCGGGC GATCAAAGAT TTGCTCGGTT TTACTTGTTG CTGAGGGGGT GGGTTAGTGT GAATTGTGAA
TTTGTGATGC GATCATGGCC ATGATCTTGG GGGTTTGTGG GGGGAACAAT AGACTGGATT CGTAACATCA AGTAGACTGT
GCAGATTCTT CTGCTACAAT AGAACCAATA GAGGAGACCA CTGAAACAGC GATCCGTGCG ATCTTTAAGT GCTTTCAGAA
TTCAGATGTT CGTTTTCCCA AGTTTTATGC GCTAGTTACT TCCCAAGAAT TTTCCGCTGC GCTTGAGGTT TGCTGGATCA
TTTTTAATTT GCGTTGTGGT TATCTATCAA GATCATTAGC TAGCTGAAAT GGACTTACAA AGTCTGTTTG TGTTCAGATA
GTATTCATTT TCAGAGAACC ATCTAGCTCA TTGCTGGGTT GTAATCTTAT ACTGACACCG TAAGATATTT CATTGTTCTC
ATTCTGCCAT ACCTCAGCGA AGCATCTATA GCTGTGAAAT GCCCCATTGA ATCTAGCTCA TTGCTGGGTT GTATTGTTAT
ACTGACCCTG TAAGATATTT CGTTGTTCTC ATTCTGCCTC AGCGAAGCAT CTTTAGCTGT GAAATGCTCC ATTGATTGCA
TCTTTAATTC TCGCATCGGA TAACATCTTG AGTAACGGCT GTACTGGAAT GTTTAAAACT GGTAGCATTA GGGCATTGTT
CTTCAGGCAA AGTATCCTTT GGTGATCATA GGACTACTCA TTCTAGCTGT GATTCAAATC CACTTGCTAA TTAATTGTTT
AGGAAAAGCG CTTGTTTGGG TAGTCCGGTA ATGTGACTTT CAATTAAATG TTTCTATATG TTGGGAGTAT TTTGTCTGTT
TAAATCCTAT TAGATTTTGC TCTGCCCCTT TATGTTTAGC ACTGTATCTT ACATGATGAA ATATTGTTTT TAATTCTTAT
GCTCCTTATC ATAATACTTC TGAGTTCGAt acttcctccg tttcacaatg taagagtttc tagcattgcc cgcattcatt
tagatgttaa tgaacctaga catgtgtatg tgtttagatt cattaacatc tatatgaatg tgggcaatgc tagaaagact
tacattgtga aacggaggga gtaTAAATTT TGTTACTGCA TATTGGAGTC AACAAATGCT TATTGTCTTA TTGAATGCGA
CATGGAATGG CGAATATAGC ATATATCCAT ATAGTGATCA CAACTATATT TCCTTTTGTT TACTGCTTTT TCAGTCATCC
ATGTATTCAT AATCTGTAGA ATGAAAGAGG CTAATTTTAG GCATATCTTT GTTTTAATTT TATCTCAGTT CAAGGAGCTT
GCACAAGCTT ATGAGGTATT GAGTGACCCG GAGAAACGTG AAATCTATGA CCAATATGGT GAAGATGCCC TCAAGGAAGG
AATGGGTGGA GGCGGATCCC ATGttgatcc atttgacatc ttttcatcat tctttggacc ttcttttggt ggtatttttt
gaagacaata cattttcctG TGTGATTGTG TTGAACTCTG TTAATCTCTT GTTTTGTTGA TGTAATGAAA TTTCGTTTGT
TTATGTTTTG AGCACAGGTG GTGGCAGCAG CAGGGGCAGA AGGCAAAGGA GGGGAGAGGA TGTGATCCAT CCGCTTAAGG
TTTCTCTAGA AGATCTTTAC AATGGTACTT CAAAGAAGCT CTCTCTTTCC CGCAATGTCC TCTGCGCCAA GTGCAAGGGG
TAAGTCTGGT TTGCCCTAGC ATAGTAAACT ATGCATTTTC ACAATCCTGC TCTTGAACAT TACTCCCTGT TCATTTCAGC
AAGGGTTCCA AGTCTGGTGC TTCCATGAGG TGCCCAGGTT GCCAGGGGTC TGGCATGAAA ATCACCATCC GCCAGCTGGG
GCCTTCCATG ATACAGCAGA TGCAGCAGCC TTGCAATGAG TGTAAGGGGA CTGGAGAGAG CATTAATGAG AAGGATCGCT
GCCCAGGCTG CAAGGGCGAG AAGGTTATTC AGGAGAAGAA GGTTCTGGAG GTTCACGTTG AGAAGGGGAT GCAACACAAT
CAGAAGATCA CTTTCCCTGG TGAAGCTGAT GAGGCGGTAT GATTGTTTCA TCTATTAGGG TAGTTTCTAT AGATTGACTC
AATGACCAGA ACTATATTGA AGAATGTTTT ACTTGCAGCC TGATACCGTT ACGGGAGACA TTGTATTCGT CCTCCAGCAG
AAGGACCACT CCAAGTTCAA AAGGAAGGGC GATGATCTCT TTTATGAGCA CACCTTATCT CTGACTGAAG CACTTTGTGG
TTTCCAATTT GTCCTGACAC ATCTGGACAA CAGACAGCTG CTCATTAAGT CAAACCCCGG TGAAGTTGTT AAGCCTGGTA
AGACCTTGTA GATGTTAAGA GCAATGTAGT ATTTATGCAA CTGTACTTGT CGGTAATCCT TGTCTCATAT ATTTGAGCAG
ACCAATTCAA GGCAATAAAC GATGAGGGAA TGCCAATGTA CCAGAGGCCT TTCATGAAGG GGAAGCTCTA CATTCATTTC
ACGGTGGAGT TCCCTGATTC CCTGGCGCCT GAACAATGCA AGGCTCTCGA GGCTGTGCTT CCACCGAAGC CTGCATCCCA
GCTGACAGAA ATGGAGATAG ATGAATGCGA GGAGACCACG ATGCACGatg tcaacaacat tgaggaagag atgcgcagga
aagcccaagc tgctcaggag gcgtatgatg aggacgatga gatgcctgga ggtgcccaga gagttcagtg cgCGCAACAG
TAAGCAGAGT ATGTCATCTA GGAAACTCGT CATTGGTTCA CAAATCAACG TCGTCGCAAA GGTTTGCCGT AAATTTTTGG
ACCCAAAGAT GATTGTGCTC TGTTTCCCGT TGCGGCGAAC ATGAAGATAG TGAAGCTGAT TTTACACCCC TTAAGCCGGG
ACTGTATCCC TTTTGTTTGC GACTTAAAAA ATGCTACTCG TATCTAGTAA TAGCTGGCTA CGTTTTACTA TGCTGTGAGA
CTCGTAGAGT TTTACCTCCT AAAAAGAAAC TCGGTATGTT GTGAATGC

Locus: Os03g0648400

Loading...

Locus: Os03g0648400

Loading...