Os03t0650400-01

Locus

Os03g0650400

Description

Similar to ameiotic 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsAM1, SWI1, Osam1, AM1

Oryzabase Gene Name Synonym(s)

AMEIOTIC1

Transcript Evidence

AK064367 (DDBJ, Best hit)

Protein Evidence

NP_001139538.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

002-108-C06 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0650400-01)

RiceXPro (AK064367)

Others

Oryzabase (10374)

KEGG (Os03t0650400-01)

Transcript

2916 bp

>Os03t0650400-01 Similar to ameiotic 1.
aaaaagagaaaaaggaaaatctcccctcccgtctcgtcgtctcctccgctccttgcgcca
tctcgcggccgaacaggggagaggaggggaggggatcctggtgagGTCTCTGACGCGGAG
CACATGGACGCGGAGATGGCGGCTCCTGCGCTTGCGGCAGCTCATCTGCTGGACTCGCCC
ATGAGGCCACAGGTGAGCAGATACTACTCCAAGAAGAGGGGTAGCAGCCACAGCAGAAAT
GGCAAGGATGATGCCAACCATGACGAGTCCAAGAACCAATCACCCGGCTTGCCCCTGAGC
AGACAGAGCCTGTCCTCATCTGCCACCCACACCTACCACACCGGAGGGTTCTACGAGATC
GACCACGAGAAGCTTCCCCCCAAATCCCCAATTCATCTCAAGTCCATACGCGTGGTAAAG
GTGAGCGGCTACACAAGCCTGGACGTCACAGTGAGCTTCCCGTCCCTCCTGGCGCTGCGA
AGCTTCTTCTCCTCCTCCCCACGGTCGTGCACTGGGCCGGAGCTCGACGAGCGCTTCGTC
ATGAGCAGCAACCACGCGGCCCGCATCCTGCGCCGTCGGGTGGCCGAGGAGGAGCTCGCG
GGCGACGTGATGCACCAGGACAGCTTCTGGCTCGTCAAGCCCTGCCTCTATGACTTCTCC
GCGTCGTCACCACATGATGTGCTGACCCCGTCGCCGCCGCCTGCCACAGCGCAGGCGAAG
GCGCCGGCAGCCAGTTCCTGCCTTCTCGACACCTTGAAGTGCGACGGCGCCGGGTGGGGC
GTGAGGCGCCGTGTCAGGTACATTGGTCGCCACCACGATGCTTCCAAGGAGGCCAGCGCT
GCCAGCCTCGATGGCTACAACACAGAGGTCAGCGTCCAGGAGGAGCAGCAGCAGCGACTG
CGGCTTCGACTGCGGTTGCGACAACGCCGGGAGCAGGAAGACAACAAGAGCACTAGCAAT
GGCAAGAGGAAGCGGGAGGAGGCAGAGAGCAGCATGGACAAGAGCAGAGCCGCCAGGAAG
AAGAAAGCCAAGACTTACAAGAGTCCCAAGAAGGTGGAGAAGAGGCGCGTCGTGGAGGCT
AAAGACGGCGACCCTCGGCGCGGCAAGGACCGGTGGTCGGCCGAGCGGTACGCAGCGGCG
GAGAGGAGCCTGCTGGATATAATGCGCTCCCATGGTGCCTGCTTCGGTGCGCCGGTGATG
CGGCAGGCTCTGCGGGAGGAAGCCCGCAAGCATATCGGTGACACCGGCCTCCTTGACCAC
CTGCTCAAGCACATGGCCGGCAGGGTACCGGAAGGCAGCGCGGACCGGTTCCGTCGCCGG
CACAATGCGGATGGTGCCATGGAGTACTGGCTGGAGCCGGCGGAGCTTGCCGAGGTACGG
CGGCTGGCTGGAGTGTCTGATCCATACTGGGTGCCGCCACCTGGGTGGAAGCCAGGTGAT
GACGTGTCCGCAGTCGCCGGTGACCTCCTGGTCAAGAAGAAGGTGGAAGAGCTCGCTGAG
GAGGTTGATGGTGTAAAAAGGCACATCGAGCAGCTCAGTTCTAATTTGGTGCAGCTGGAG
AAGGAAACAAAATCTGAGGCAGAGCGATCTTACAGCTCTAGGAAGgagaagtatcagaag
ttgatgaaggcaaatgaaaAGCTCGAGAAACAGGTGTTATCTATGAAGGATAAATACAAG
CTTGTGCTGGAGAAGAATGATAAACTGGAGGAACAGATGGCTAGTCTCTCCAGCTCCTTC
CTTTCTTTGAAGGAACAATTGCTGCTGCCAAGAAATGGAGATAATCTGAACATGGAAAGG
GAAAGGGTGGAAGTGACTTTGGGCAAGCAAGAAGGCCTTGTTCCCGGCGAACCACTGTAT
GTTGATGGTGGTGACCGGATCAGCCAGCAAGCAGATGCCACCGTCGTCCAAGTCGGCGAG
AAGAGGACGGCGAGGAAGAGCAGCTTCCGCATCTGCAAGCCACAGGGAACGTTCATGTGG
CCACACATGGCGTCTGGCACGAGCATGGCCATCAGTGGGGGAGGCAGCAGCAGCTGCCCT
GTCGCCTCCGGGCCAGAGCAGCTCCCTCGCAGCAGCAGCTGCCCCAGCATTGGGCCTGGT
GGCCTCCCGCCGTCGTCACGAGCCCCAGCCGAGGTGGTGGTCGCGTCGCCACTGGACGAG
CACGTGGCGTTCCGCGGGGGCTTCAACACGCCGCCCTCGGCATCGTCCACCAACGCCGCC
GCTGCCGCCAAGCTGCCTCCCCTGCCCAGCCCGACGTCACCTCTCCAGACACGGGCCCTG
TTCGCCGCTGGCTTCACTGTCCCGGCATTACACAACTTCTCCGGCCTCACCTTACGCCAT
GTGGACTCCTCGTCGCCGTCGTCCGCGCCATGCGGTGCTAGGGAGAAGATGGTGACCCTG
TTCGATGGAGACTGCCGGGGGATCAGCGTCGTGGGCACCGAGCTGGCACTGGCCACTCCG
TCCTACTGCTGATCAAGTTCTTCCCTCCCCTTCTGCTTCGCCACCCGCCCCCATAATTAA
TTAATTAATCACGGAACCAAAAGATTTATTCTAGTTTAAGGTAGAGAAATGATAACATAA
GAAGACAATAACAACACACACACACACACACAAAAATATAAGATAGAAGAGGAAGAGTTA
TTTTTCTCGGTTACAAACTCAAAGTTGCAGTTTAGAACTTGGTAAGTAGATGTTTCAGGC
TGGTTGGTCAGTTAATGGTTTGAGTCCCCATGTCTGTACTGATCGATGTAAGCCTGACAA
ATTTTGGTAGGCTGATACTCTCCCTAGCCCTTCGCGTGACACATTCGAAGTGGAATGTGT
CCAGTTTTCTGACGGGCTAGGTCCGCTATTTTGTCCTGGATACATATTCATTATTCATCA
TTGCCATTGGTAGTATATAATTTAAGATCTGATTCT

CDS

2349 bp

>Os03t0650400-01 Similar to ameiotic 1.
ATGGACGCGGAGATGGCGGCTCCTGCGCTTGCGGCAGCTCATCTGCTGGACTCGCCCATG
AGGCCACAGGTGAGCAGATACTACTCCAAGAAGAGGGGTAGCAGCCACAGCAGAAATGGC
AAGGATGATGCCAACCATGACGAGTCCAAGAACCAATCACCCGGCTTGCCCCTGAGCAGA
CAGAGCCTGTCCTCATCTGCCACCCACACCTACCACACCGGAGGGTTCTACGAGATCGAC
CACGAGAAGCTTCCCCCCAAATCCCCAATTCATCTCAAGTCCATACGCGTGGTAAAGGTG
AGCGGCTACACAAGCCTGGACGTCACAGTGAGCTTCCCGTCCCTCCTGGCGCTGCGAAGC
TTCTTCTCCTCCTCCCCACGGTCGTGCACTGGGCCGGAGCTCGACGAGCGCTTCGTCATG
AGCAGCAACCACGCGGCCCGCATCCTGCGCCGTCGGGTGGCCGAGGAGGAGCTCGCGGGC
GACGTGATGCACCAGGACAGCTTCTGGCTCGTCAAGCCCTGCCTCTATGACTTCTCCGCG
TCGTCACCACATGATGTGCTGACCCCGTCGCCGCCGCCTGCCACAGCGCAGGCGAAGGCG
CCGGCAGCCAGTTCCTGCCTTCTCGACACCTTGAAGTGCGACGGCGCCGGGTGGGGCGTG
AGGCGCCGTGTCAGGTACATTGGTCGCCACCACGATGCTTCCAAGGAGGCCAGCGCTGCC
AGCCTCGATGGCTACAACACAGAGGTCAGCGTCCAGGAGGAGCAGCAGCAGCGACTGCGG
CTTCGACTGCGGTTGCGACAACGCCGGGAGCAGGAAGACAACAAGAGCACTAGCAATGGC
AAGAGGAAGCGGGAGGAGGCAGAGAGCAGCATGGACAAGAGCAGAGCCGCCAGGAAGAAG
AAAGCCAAGACTTACAAGAGTCCCAAGAAGGTGGAGAAGAGGCGCGTCGTGGAGGCTAAA
GACGGCGACCCTCGGCGCGGCAAGGACCGGTGGTCGGCCGAGCGGTACGCAGCGGCGGAG
AGGAGCCTGCTGGATATAATGCGCTCCCATGGTGCCTGCTTCGGTGCGCCGGTGATGCGG
CAGGCTCTGCGGGAGGAAGCCCGCAAGCATATCGGTGACACCGGCCTCCTTGACCACCTG
CTCAAGCACATGGCCGGCAGGGTACCGGAAGGCAGCGCGGACCGGTTCCGTCGCCGGCAC
AATGCGGATGGTGCCATGGAGTACTGGCTGGAGCCGGCGGAGCTTGCCGAGGTACGGCGG
CTGGCTGGAGTGTCTGATCCATACTGGGTGCCGCCACCTGGGTGGAAGCCAGGTGATGAC
GTGTCCGCAGTCGCCGGTGACCTCCTGGTCAAGAAGAAGGTGGAAGAGCTCGCTGAGGAG
GTTGATGGTGTAAAAAGGCACATCGAGCAGCTCAGTTCTAATTTGGTGCAGCTGGAGAAG
GAAACAAAATCTGAGGCAGAGCGATCTTACAGCTCTAGGAAGgagaagtatcagaagttg
atgaaggcaaatgaaaAGCTCGAGAAACAGGTGTTATCTATGAAGGATAAATACAAGCTT
GTGCTGGAGAAGAATGATAAACTGGAGGAACAGATGGCTAGTCTCTCCAGCTCCTTCCTT
TCTTTGAAGGAACAATTGCTGCTGCCAAGAAATGGAGATAATCTGAACATGGAAAGGGAA
AGGGTGGAAGTGACTTTGGGCAAGCAAGAAGGCCTTGTTCCCGGCGAACCACTGTATGTT
GATGGTGGTGACCGGATCAGCCAGCAAGCAGATGCCACCGTCGTCCAAGTCGGCGAGAAG
AGGACGGCGAGGAAGAGCAGCTTCCGCATCTGCAAGCCACAGGGAACGTTCATGTGGCCA
CACATGGCGTCTGGCACGAGCATGGCCATCAGTGGGGGAGGCAGCAGCAGCTGCCCTGTC
GCCTCCGGGCCAGAGCAGCTCCCTCGCAGCAGCAGCTGCCCCAGCATTGGGCCTGGTGGC
CTCCCGCCGTCGTCACGAGCCCCAGCCGAGGTGGTGGTCGCGTCGCCACTGGACGAGCAC
GTGGCGTTCCGCGGGGGCTTCAACACGCCGCCCTCGGCATCGTCCACCAACGCCGCCGCT
GCCGCCAAGCTGCCTCCCCTGCCCAGCCCGACGTCACCTCTCCAGACACGGGCCCTGTTC
GCCGCTGGCTTCACTGTCCCGGCATTACACAACTTCTCCGGCCTCACCTTACGCCATGTG
GACTCCTCGTCGCCGTCGTCCGCGCCATGCGGTGCTAGGGAGAAGATGGTGACCCTGTTC
GATGGAGACTGCCGGGGGATCAGCGTCGTGGGCACCGAGCTGGCACTGGCCACTCCGTCC
TACTGCTGA

Protein

783 aa

>Os03t0650400-01 Similar to ameiotic 1.
MDAEMAAPALAAAHLLDSPMRPQVSRYYSKKRGSSHSRNGKDDANHDESKNQSPGLPLSR
QSLSSSATHTYHTGGFYEIDHEKLPPKSPIHLKSIRVVKVSGYTSLDVTVSFPSLLALRS
FFSSSPRSCTGPELDERFVMSSNHAARILRRRVAEEELAGDVMHQDSFWLVKPCLYDFSA
SSPHDVLTPSPPPATAQAKAPAASSCLLDTLKCDGAGWGVRRRVRYIGRHHDASKEASAA
SLDGYNTEVSVQEEQQQRLRLRLRLRQRREQEDNKSTSNGKRKREEAESSMDKSRAARKK
KAKTYKSPKKVEKRRVVEAKDGDPRRGKDRWSAERYAAAERSLLDIMRSHGACFGAPVMR
QALREEARKHIGDTGLLDHLLKHMAGRVPEGSADRFRRRHNADGAMEYWLEPAELAEVRR
LAGVSDPYWVPPPGWKPGDDVSAVAGDLLVKKKVEELAEEVDGVKRHIEQLSSNLVQLEK
ETKSEAERSYSSRKEKYQKLMKANEKLEKQVLSMKDKYKLVLEKNDKLEEQMASLSSSFL
SLKEQLLLPRNGDNLNMERERVEVTLGKQEGLVPGEPLYVDGGDRISQQADATVVQVGEK
RTARKSSFRICKPQGTFMWPHMASGTSMAISGGGSSSCPVASGPEQLPRSSSCPSIGPGG
LPPSSRAPAEVVVASPLDEHVAFRGGFNTPPSASSTNAAAAAKLPPLPSPTSPLQTRALF
AAGFTVPALHNFSGLTLRHVDSSSPSSAPCGAREKMVTLFDGDCRGISVVGTELALATPS
YC*

5'UTR

chr03:25234046..25234150 (+ strand) : 105 bp

chr03:25234465..25234482 (+ strand) : 18 bp

CDS

chr03:25234483..25234542 (+ strand) : 60 bp

chr03:25235919..25236078 (+ strand) : 160 bp

chr03:25236203..25236279 (+ strand) : 77 bp

chr03:25236411..25237510 (+ strand) : 1100 bp

chr03:25237624..25237708 (+ strand) : 85 bp

chr03:25238155..25238217 (+ strand) : 63 bp

chr03:25238647..25238730 (+ strand) : 84 bp

chr03:25238817..25239407 (+ strand) : 591 bp

chr03:25239622..25239750 (+ strand) : 129 bp

3'UTR

chr03:25239751..25240194 (+ strand) : 444 bp

FASTA

>Os03t0650400-01 class=Sequence position=chr03:25234046..25240194 (+ strand)
aaaaagagaa aaaggaaaat ctcccctccc gtctcgtcgt ctcctccgct ccttgcgcca tctcgcggcc gaacagggga
gaggagggga ggggatcctg gtgaggtgag catccgcatc ctctttctca tccatctctc tctccccact tctctctgga
atttgctcgc gtttctcttc tagatctgga agaagctctt ctctcttcat ttcacagcct taaccttact cctcccaagt
agtagtagca gtttgcttgc ttgtttgttc ccccaaaaag tttgATCCGC CCCTGGCTCC TGTGAATTTA TTCGATCGCT
TCAATGTGTG CGGATGTGCC CGTGCTGTGG CTGTGAGATC GATGGATCAA TCTCTGGATT AATTTTGCTT TTGCTTTTTT
TGTTCTTTTG GGGACGAAGG TCTCTGACGC GGAGCACATG GACGCGGAGA TGGCGGCTCC TGCGCTTGCG GCAGCTCATC
TGCTGGACTC GCCCATGGTA CAGACGCGCA TCTTCGCTGA CACTTCTTTC CTTGCGCCTT TTTTTTTTCA ATTTCCATCT
CCTCGCCTGG TTAGTTTCAT TTCATTGATC GCATATGCTC AGTGTGTACG AGTTGCTTTT GCTGATTAAA ATTCGATCGG
TGGGGGTGAG TGTTTGGGGG GTTTAGATGG TTTGCTATTT GGATGCAGTT GCATGGTTGT GTGGATTTCT CTACCAATGA
ATGTCTTAGT AGTAATTGGA TCAGTACACT TAATGCAGCT GATGGATTGA ATCAATTTGG GTGGTTTGTT GTGTAATTAC
TAGCGATTGC GATGCATGTG TGGCGAAATT AGTGGGCTCA ATCCATAGCT TAGTAGTAGA ATCCAAGACT TGGAATTTCA
TGCAAAGATC CCTATTAGGC TTGTTAATCA ATCTCTACAT GTTGATGTTA CGTTCTTTGG AACCGCACTT GTGGCGTACT
ATTTCCAGTC AATTTATTTT GCCTGCTGCC TGTTGCGAGT ACAACCAGAA ATTGCTGATT TTAGTGGACA TGTCATAGAT
GGAACTATAT GTGTCTTGCA TGTTTCTAAT GTTACTCATG CACGATAAGT GGTTTTGTTA AGTGAAAGAT GCAGTTGGGG
TAATATTAGT TCAAGTTGTT AATAAGTTGA CAATGCAGTG ATGCACGCTC TTTTCGTTTG GTACGATGTC CGGTTAATAT
GGTATATCTT GAAGATTAAT TTGCATGTTC TAATTAACCA AAGGGCTTAA AATTTGACAT GTTTCAGTTG TCCAACTAAA
CTGGAGATAG ATACACGCGT CATTGAGTTT TCTTTTACTG ATTAGGCGAT TACTTTCTGA AAACCATATG TTTTGACCAA
CTTGCTGTCA TAGTTTTTTT TTTTTAACCT CATGGAGTGA TAGAATTAGC AATAATGAAC TTTAGTTCCT ATATATGTTT
AAGGTTCCAT ATACTTGCAT GCATGTGCAA TTTACTGACA CTAGTGCTGT TAAGTTCAGT TAACATCAGC AGCTAATTAG
TCTGGGCAGT GTCACAGAAA AAAAAATCTT AAAGCAATAC TAGATCACAG ACTCACAGCT AGTAATTCGG TTCACACATA
TGGATCACTT TGTCAGGAAA TCATGCATGC ACAGAAAAAT TGCTCCCCTG TGTTTATTTT GCTTCTAGGT ACAGTACAGA
GTGGTACGTG ATGTTAATTG GTGTCTCTCT TCCACAAGGC TAGAGGTTTA ATTCCATCTC ACGCACGCTG CACGCGCACC
CTCTATCCCA AGCTTTCCCG TTTCAGTATC TCTGATCGCT CACTGCACCT GCATTACACG AGCCAAAACG CCTGACCTGT
GCTTTGCATG TGTTGTGTTG GCCCATTTCC AAGAGGCCAC AGGTGAGCAG ATACTACTCC AAGAAGAGGG GTAGCAGCCA
CAGCAGAAAT GGCAAGGATG ATGCCAACCA TGACGAGTCC AAGAACCAAT CACCCGGCTT GCCCCTGAGC AGACAGAGCC
TGTCCTCATC TGCCACCCAC ACCTACCACA CCGGTGAGCA GAGCAATGCC TCCAGGCTTT GAACTCTATC GTCTAGTTTA
TATTTGTGCA AGAGCAGTTC CCCCAACTCT GTTTGTGCCA AGTTCTTGAA AACCTGTGCT GTTTTTGGTT TGATCAGGAG
GGTTCTACGA GATCGACCAC GAGAAGCTTC CCCCCAAATC CCCAATTCAT CTCAAGTCCA TACGCGTGGT AAAGGTGAGC
CTTTTTTTTT CTTACTCGTA CACTCGACTG CTAGCTTTGA TCTGGATTGA TTTGATGAAT TGTTCTCGAA ATGTTTGATC
TGGATTGCTT CTCGCTCGTG GTGTTGTGGT CTTTGGTGGG TGCAGGTGAG CGGCTACACA AGCCTGGACG TCACAGTGAG
CTTCCCGTCC CTCCTGGCGC TGCGAAGCTT CTTCTCCTCC TCCCCACGGT CGTGCACTGG GCCGGAGCTC GACGAGCGCT
TCGTCATGAG CAGCAACCAC GCGGCCCGCA TCCTGCGCCG TCGGGTGGCC GAGGAGGAGC TCGCGGGCGA CGTGATGCAC
CAGGACAGCT TCTGGCTCGT CAAGCCCTGC CTCTATGACT TCTCCGCGTC GTCACCACAT GATGTGCTGA CCCCGTCGCC
GCCGCCTGCC ACAGCGCAGG CGAAGGCGCC GGCAGCCAGT TCCTGCCTTC TCGACACCTT GAAGTGCGAC GGCGCCGGGT
GGGGCGTGAG GCGCCGTGTC AGGTACATTG GTCGCCACCA CGATGCTTCC AAGGAGGCCA GCGCTGCCAG CCTCGATGGC
TACAACACAG AGGTCAGCGT CCAGGAGGAG CAGCAGCAGC GACTGCGGCT TCGACTGCGG TTGCGACAAC GCCGGGAGCA
GGAAGACAAC AAGAGCACTA GCAATGGCAA GAGGAAGCGG GAGGAGGCAG AGAGCAGCAT GGACAAGAGC AGAGCCGCCA
GGAAGAAGAA AGCCAAGACT TACAAGAGTC CCAAGAAGGT GGAGAAGAGG CGCGTCGTGG AGGCTAAAGA CGGCGACCCT
CGGCGCGGCA AGGACCGGTG GTCGGCCGAG CGGTACGCAG CGGCGGAGAG GAGCCTGCTG GATATAATGC GCTCCCATGG
TGCCTGCTTC GGTGCGCCGG TGATGCGGCA GGCTCTGCGG GAGGAAGCCC GCAAGCATAT CGGTGACACC GGCCTCCTTG
ACCACCTGCT CAAGCACATG GCCGGCAGGG TACCGGAAGG CAGCGCGGAC CGGTTCCGTC GCCGGCACAA TGCGGATGGT
GCCATGGAGT ACTGGCTGGA GCCGGCGGAG CTTGCCGAGG TACGGCGGCT GGCTGGAGTG TCTGATCCAT ACTGGGTGCC
GCCACCTGGG TGGAAGCCAG GTGATGACGT GTCCGCAGTC GCCGGTGACC TCCTGGTCAA GAAGAAGGTG GAAGAGCTCG
CTGAGGAGGT TGATGGTGTA AAAAGGTCTC CTTTCTCTCG CTTTTTTGCA GCTTCTACTT CTTGTTTGGA GAAATACCAA
CATTTTTGTC AGTTCTACGA GTTCTGTGCT AAATTTCACT TGGGCTGGTG GTGTGAAGGC ACATCGAGCA GCTCAGTTCT
AATTTGGTGC AGCTGGAGAA GGAAACAAAA TCTGAGGCAG AGCGATCTTA CAGCTCTAGG AAGGTATATA GCCCATCAAT
CCTGTCGATT ATTTCCCTTG CATCCATTTT CCTTCTGTTT ATTGTTGTTA CTTCTCAAGA AAGCGGGAAT GTTTTTTTGT
TTGCCCATTG TGACTTAAAA TGTAACAAGC TAATATAACA CTTGAGTTGC ATTGACCTGC TTGCCTGTAT TTTGAGTTGC
ATTGACCTGC CTGCCTATAT TTTGAAATCT AGTCCTTTTA TTTGTTTTTT CAGAATTTCC ATGTAGGTAT TATCAGTAGT
TATGGCAATT GGCAATCTGG TCTTTTTCAA TCTCTGAAAG TGTAAATTGT GAAGGACATA TATGCAGCCA GCTAAAATTT
CTCAGCTTTA CTTACATTGA CAAAAGCATA CACTTTTGGC ATGCCTCTCT TCTGTTCTGC TCTGCTTTCC ATTATTGGAG
CACTCAtttc tttagcattt gtttttcagg agaagtatca gaagttgatg aaggcaaatg aaaAGCTCGA GAAACAGGTG
TTATCTATGA AGGTAACTAA ACAACACCTC TCATCCTACT CCTGCGCTTT CATCTCAAAC TATGCAAAAG CACTGGTACC
TTGTTTAGCA ACAAATGATC CACGTCTCTG ATCATGTTCG ATTATATGCC TGCACTTACA TTAAGGTAAA ACACATATCA
TTTCCTTGTT TAAATTACAG GACATGTATG AGCATCTGGT TCAGAAAAAG GGTAAGCTGA AGAAGGAGGT GCTGTCCTTG
AAGGTATACC CCTGCAGATA CACCTGAAAT TTCCACCATG ATCTGCACTT CACCACACAT TATGATTTTC AAGCAAACTA
AGCAGTTATA CTCCTTGGGA CTATTTTACT TTGGTCCACC ATGTTTCTGA TTATTCTGTT GTACCTAGCT ATTTGCATGT
TTAATTATAC AACTCTTGAT CATCAACTGG TACCTTTTCA GGATAAATAC AAGCTTGTGC TGGAGAAGAA TGATAAACTG
GAGGAACAGA TGGCTAGTCT CTCCAGCTCC TTCCTTTCTT TGAAGGTTGG TTGCCCTTTG TGGGTTCTGC TTCTAATTGT
ACCTGAAACA CATGCCTTAT TCCAAATCAC CTGACACCTC TGCATGCACA GGAACAATTG CTGCTGCCAA GAAATGGAGA
TAATCTGAAC ATGGAAAGGG AAAGGGTGGA AGTGACTTTG GGCAAGCAAG AAGGCCTTGT TCCCGGCGAA CCACTGTATG
TTGATGGTGG TGACCGGATC AGCCAGCAAG CAGATGCCAC CGTCGTCCAA GTCGGCGAGA AGAGGACGGC GAGGAAGAGC
AGCTTCCGCA TCTGCAAGCC ACAGGGAACG TTCATGTGGC CACACATGGC GTCTGGCACG AGCATGGCCA TCAGTGGGGG
AGGCAGCAGC AGCTGCCCTG TCGCCTCCGG GCCAGAGCAG CTCCCTCGCA GCAGCAGCTG CCCCAGCATT GGGCCTGGTG
GCCTCCCGCC GTCGTCACGA GCCCCAGCCG AGGTGGTGGT CGCGTCGCCA CTGGACGAGC ACGTGGCGTT CCGCGGGGGC
TTCAACACGC CGCCCTCGGC ATCGTCCACC AACGCCGCCG CTGCCGCCAA GCTGCCTCCC CTGCCCAGCC CGACGTCACC
TCTCCAGACA CGGGCCCTGT TCGCCGCTGG CTTCACTGTC CCGGCATTAC ACAACTTCTC CGGCCTCACC TTACGCCATG
TGGTAAGTTC AAACATCTGC ATCCGCACTT TGATTTCAAC TCCCAACTCC TCCCAAGAAC TGGAATTCCT TGAGCCTGTC
AGATGCAAGA TGGACGGCTT GGATGACCAA CCAGTCACCC ACAGAGAACA CTTCTCTTCC CTTCTCTTTC TTCAACATGT
GACACCTGAC ACTGATAATC TCGTATTCAT GGCTGGCTGT TCGTCTGTCT GTGCAGGACT CCTCGTCGCC GTCGTCCGCG
CCATGCGGTG CTAGGGAGAA GATGGTGACC CTGTTCGATG GAGACTGCCG GGGGATCAGC GTCGTGGGCA CCGAGCTGGC
ACTGGCCACT CCGTCCTACT GCTGATCAAG TTCTTCCCTC CCCTTCTGCT TCGCCACCCG CCCCCATAAT TAATTAATTA
ATCACGGAAC CAAAAGATTT ATTCTAGTTT AAGGTAGAGA AATGATAACA TAAGAAGACA ATAACAACAC ACACACACAC
ACACAAAAAT ATAAGATAGA AGAGGAAGAG TTATTTTTCT CGGTTACAAA CTCAAAGTTG CAGTTTAGAA CTTGGTAAGT
AGATGTTTCA GGCTGGTTGG TCAGTTAATG GTTTGAGTCC CCATGTCTGT ACTGATCGAT GTAAGCCTGA CAAATTTTGG
TAGGCTGATA CTCTCCCTAG CCCTTCGCGT GACACATTCG AAGTGGAATG TGTCCAGTTT TCTGACGGGC TAGGTCCGCT
ATTTTGTCCT GGATACATAT TCATTATTCA TCATTGCCAT TGGTAGTATA TAATTTAAGA TCTGATTCT

Locus: Os03g0650400

Loading...

Locus: Os03g0650400

Loading...