Os03t0650400-02

Locus

Os03g0650400

Description

Homolog of Arabidopsis SWI1 and maize AM1, Fundamental role in building the proper chromosome structure at the beginning of meiosis, Required for the leptotene-zygotene transition

RAP-DB Gene Symbol Synonym(s)

OsAM1

RAP-DB Gene Name Synonym(s)

AMEIOTIC1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsAM1, SWI1, Osam1, AM1

Oryzabase Gene Name Synonym(s)

AMEIOTIC1

Transcript Evidence

AK101644

Protein Evidence

Q53KW9

Literature

PMID: 21221128

Note

Manual Curation

September 24, 2020

Experimentally confirmed subcellular location

nucleus (GO:0005634)

chromosome (GO:0005694)

Full-length cDNA

J033055N07 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0650400-02)

RiceXPro (AK101644)

Others

Oryzabase (10374)

Transcript

2905 bp

>Os03t0650400-02 Homolog of Arabidopsis SWI1 and maize AM1, Fundamental role in building the proper chromosome structure at the beginning of meiosis, Required for the leptotene-zygotene transition
gtcgtctcctccgctccttgcgccatctcgcggccgaacaggggagaggaggggagggga
tcctggtgagGTCTCTGACGCGGAGCACATGGACGCGGAGATGGCGGCTCCTGCGCTTGC
GGCAGCTCATCTGCTGGACTCGCCCATGAGGCCACAGGTGAGCAGATACTACTCCAAGAA
GAGGGGTAGCAGCCACAGCAGAAATGGCAAGGATGATGCCAACCATGACGAGTCCAAGAA
CCAATCACCCGGCTTGCCCCTGAGCAGACAGAGCCTGTCCTCATCTGCCACCCACACCTA
CCACACCGGAGGGTTCTACGAGATCGACCACGAGAAGCTTCCCCCCAAATCCCCAATTCA
TCTCAAGTCCATACGCGTGGTAAAGGTGAGCGGCTACACAAGCCTGGACGTCACAGTGAG
CTTCCCGTCCCTCCTGGCGCTGCGAAGCTTCTTCTCCTCCTCCCCACGGTCGTGCACTGG
GCCGGAGCTCGACGAGCGCTTCGTCATGAGCAGCAACCACGCGGCCCGCATCCTGCGCCG
TCGGGTGGCCGAGGAGGAGCTCGCGGGCGACGTGATGCACCAGGACAGCTTCTGGCTCGT
CAAGCCCTGCCTCTATGACTTCTCCGCGTCGTCACCACATGATGTGCTGACCCCGTCGCC
GCCGCCTGCCACAGCGCAGGCGAAGGCGCCGGCAGCCAGTTCCTGCCTTCTCGACACCTT
GAAGTGCGACGGCGCCGGGTGGGGCGTGAGGCGCCGTGTCAGGTACATTGGTCGCCACCA
CGATGCTTCCAAGGAGGCCAGCGCTGCCAGCCTCGATGGCTACAACACAGAGGTCAGCGT
CCAGGAGGAGCAGCAGCAGCGACTGCGGCTTCGACTGCGGTTGCGACAACGCCGGGAGCA
GGAAGACAACAAGAGCACTAGCAATGGCAAGAGGAAGCGGGAGGAGGCAGAGAGCAGCAT
GGACAAGAGCAGAGCCGCCAGGAAGAAGAAAGCCAAGACTTACAAGAGTCCCAAGAAGGT
GGAGAAGAGGCGCGTCGTGGAGGCTAAAGACGGCGACCCTCGGCGCGGCAAGGACCGGTG
GTCGGCCGAGCGGTACGCAGCGGCGGAGAGGAGCCTGCTGGATATAATGCGCTCCCATGG
TGCCTGCTTCGGTGCGCCGGTGATGCGGCAGGCTCTGCGGGAGGAAGCCCGCAAGCATAT
CGGTGACACCGGCCTCCTTGACCACCTGCTCAAGCACATGGCCGGCAGGGTACCGGAAGG
CAGCGCGGACCGGTTCCGTCGCCGGCACAATGCGGATGGTGCCATGGAGTACTGGCTGGA
GCCGGCGGAGCTTGCCGAGGTACGGCGGCTGGCTGGAGTGTCTGATCCATACTGGGTGCC
GCCACCTGGGTGGAAGCCAGGTGATGACGTGTCCGCAGTCGCCGGTGACCTCCTGGTCAA
GAAGAAGGTGGAAGAGCTCGCTGAGGAGGTTGATGGTGTAAAAAGGCACATCGAGCAGCT
CAGTTCTAATTTGGTGCAGCTGGAGAAGGAAACAAAATCTGAGGCAGAGCGATCTTACAG
CTCTAGGAAGgagaagtatcagaagttgatgaaggcaaatgaaaAGCTCGAGAAACAGGT
GTTATCTATGAAGGACATGTATGAGCATCTGGTTCAGAAAAAGGGTAAGCTGAAGAAGGA
GGTGCTGTCCTTGAAGGATAAATACAAGCTTGTGCTGGAGAAGAATGATAAACTGGAGGA
ACAGATGGCTAGTCTCTCCAGCTCCTTCCTTTCTTTGAAGGAACAATTGCTGCTGCCAAG
AAATGGAGATAATCTGAACATGGAAAGGGAAAGGGTGGAAGTGACTTTGGGCAAGCAAGA
AGGCCTTGTTCCCGGCGAACCACTGTATGTTGATGGTGGTGACCGGATCAGCCAGCAAGC
AGATGCCACCGTCGTCCAAGTCGGCGAGAAGAGGACGGCGAGGAAGAGCAGCTTCCGCAT
CTGCAAGCCACAGGGAACGTTCATGTGGCCACACATGGCGTCTGGCACGAGCATGGCCAT
CAGTGGGGGAGGCAGCAGCAGCTGCCCTGTCGCCTCCGGGCCAGAGCAGCTCCCTCGCAG
CAGCAGCTGCCCCAGCATTGGGCCTGGTGGCCTCCCGCCGTCGTCACGAGCCCCAGCCGA
GGTGGTGGTCGCGTCGCCACTGGACGAGCACGTGGCGTTCCGCGGGGGCTTCAACACGCC
GCCCTCGGCATCGTCCACCAACGCCGCCGCTGCCGCCAAGCTGCCTCCCCTGCCCAGCCC
GACGTCACCTCTCCAGACACGGGCCCTGTTCGCCGCTGGCTTCACTGTCCCGGCATTACA
CAACTTCTCCGGCCTCACCTTACGCCATGTGGACTCCTCGTCGCCGTCGTCCGCGCCATG
CGGTGCTAGGGAGAAGATGGTGACCCTGTTCGATGGAGACTGCCGGGGGATCAGCGTCGT
GGGCACCGAGCTGGCACTGGCCACTCCGTCCTACTGCTGATCAAGTTCTTCCCTCCCCTT
CTGCTTCGCCACCCGCCCCCATAATTAATTAATTAATCACGGAACCAAAAGATTTATTCT
AGTTTAAGGTAGAGAAATGATAACATAAGAAGACAATAACAACACACACACACACACACA
AAAATATAAGATAGAAGAGGAAGAGTTATTTTTCTCGGTTACAAACTCAAAGTTGCAGTT
TAGAACTTGGTAAGTAGATGTTTCAGGCTGGTTGGTCAGTTAATGGTTTGAGTCCCCATG
TCTGTACTGATCGATGTAAGCCTGACAAATTTTGGTAGGCTGATACTCTCCCTAGCCCTT
CGCGTGACACATTCGAAGTGGAATGTGTCCAGTTTTCTGACGGGCTAGGTCCGCTATTTT
GTCCTGGATACATATTCATTATTCA

CDS

2412 bp

>Os03t0650400-02 Homolog of Arabidopsis SWI1 and maize AM1, Fundamental role in building the proper chromosome structure at the beginning of meiosis, Required for the leptotene-zygotene transition
ATGGACGCGGAGATGGCGGCTCCTGCGCTTGCGGCAGCTCATCTGCTGGACTCGCCCATG
AGGCCACAGGTGAGCAGATACTACTCCAAGAAGAGGGGTAGCAGCCACAGCAGAAATGGC
AAGGATGATGCCAACCATGACGAGTCCAAGAACCAATCACCCGGCTTGCCCCTGAGCAGA
CAGAGCCTGTCCTCATCTGCCACCCACACCTACCACACCGGAGGGTTCTACGAGATCGAC
CACGAGAAGCTTCCCCCCAAATCCCCAATTCATCTCAAGTCCATACGCGTGGTAAAGGTG
AGCGGCTACACAAGCCTGGACGTCACAGTGAGCTTCCCGTCCCTCCTGGCGCTGCGAAGC
TTCTTCTCCTCCTCCCCACGGTCGTGCACTGGGCCGGAGCTCGACGAGCGCTTCGTCATG
AGCAGCAACCACGCGGCCCGCATCCTGCGCCGTCGGGTGGCCGAGGAGGAGCTCGCGGGC
GACGTGATGCACCAGGACAGCTTCTGGCTCGTCAAGCCCTGCCTCTATGACTTCTCCGCG
TCGTCACCACATGATGTGCTGACCCCGTCGCCGCCGCCTGCCACAGCGCAGGCGAAGGCG
CCGGCAGCCAGTTCCTGCCTTCTCGACACCTTGAAGTGCGACGGCGCCGGGTGGGGCGTG
AGGCGCCGTGTCAGGTACATTGGTCGCCACCACGATGCTTCCAAGGAGGCCAGCGCTGCC
AGCCTCGATGGCTACAACACAGAGGTCAGCGTCCAGGAGGAGCAGCAGCAGCGACTGCGG
CTTCGACTGCGGTTGCGACAACGCCGGGAGCAGGAAGACAACAAGAGCACTAGCAATGGC
AAGAGGAAGCGGGAGGAGGCAGAGAGCAGCATGGACAAGAGCAGAGCCGCCAGGAAGAAG
AAAGCCAAGACTTACAAGAGTCCCAAGAAGGTGGAGAAGAGGCGCGTCGTGGAGGCTAAA
GACGGCGACCCTCGGCGCGGCAAGGACCGGTGGTCGGCCGAGCGGTACGCAGCGGCGGAG
AGGAGCCTGCTGGATATAATGCGCTCCCATGGTGCCTGCTTCGGTGCGCCGGTGATGCGG
CAGGCTCTGCGGGAGGAAGCCCGCAAGCATATCGGTGACACCGGCCTCCTTGACCACCTG
CTCAAGCACATGGCCGGCAGGGTACCGGAAGGCAGCGCGGACCGGTTCCGTCGCCGGCAC
AATGCGGATGGTGCCATGGAGTACTGGCTGGAGCCGGCGGAGCTTGCCGAGGTACGGCGG
CTGGCTGGAGTGTCTGATCCATACTGGGTGCCGCCACCTGGGTGGAAGCCAGGTGATGAC
GTGTCCGCAGTCGCCGGTGACCTCCTGGTCAAGAAGAAGGTGGAAGAGCTCGCTGAGGAG
GTTGATGGTGTAAAAAGGCACATCGAGCAGCTCAGTTCTAATTTGGTGCAGCTGGAGAAG
GAAACAAAATCTGAGGCAGAGCGATCTTACAGCTCTAGGAAGgagaagtatcagaagttg
atgaaggcaaatgaaaAGCTCGAGAAACAGGTGTTATCTATGAAGGACATGTATGAGCAT
CTGGTTCAGAAAAAGGGTAAGCTGAAGAAGGAGGTGCTGTCCTTGAAGGATAAATACAAG
CTTGTGCTGGAGAAGAATGATAAACTGGAGGAACAGATGGCTAGTCTCTCCAGCTCCTTC
CTTTCTTTGAAGGAACAATTGCTGCTGCCAAGAAATGGAGATAATCTGAACATGGAAAGG
GAAAGGGTGGAAGTGACTTTGGGCAAGCAAGAAGGCCTTGTTCCCGGCGAACCACTGTAT
GTTGATGGTGGTGACCGGATCAGCCAGCAAGCAGATGCCACCGTCGTCCAAGTCGGCGAG
AAGAGGACGGCGAGGAAGAGCAGCTTCCGCATCTGCAAGCCACAGGGAACGTTCATGTGG
CCACACATGGCGTCTGGCACGAGCATGGCCATCAGTGGGGGAGGCAGCAGCAGCTGCCCT
GTCGCCTCCGGGCCAGAGCAGCTCCCTCGCAGCAGCAGCTGCCCCAGCATTGGGCCTGGT
GGCCTCCCGCCGTCGTCACGAGCCCCAGCCGAGGTGGTGGTCGCGTCGCCACTGGACGAG
CACGTGGCGTTCCGCGGGGGCTTCAACACGCCGCCCTCGGCATCGTCCACCAACGCCGCC
GCTGCCGCCAAGCTGCCTCCCCTGCCCAGCCCGACGTCACCTCTCCAGACACGGGCCCTG
TTCGCCGCTGGCTTCACTGTCCCGGCATTACACAACTTCTCCGGCCTCACCTTACGCCAT
GTGGACTCCTCGTCGCCGTCGTCCGCGCCATGCGGTGCTAGGGAGAAGATGGTGACCCTG
TTCGATGGAGACTGCCGGGGGATCAGCGTCGTGGGCACCGAGCTGGCACTGGCCACTCCG
TCCTACTGCTGA

Protein

804 aa

>Os03t0650400-02 Homolog of Arabidopsis SWI1 and maize AM1, Fundamental role in building the proper chromosome structure at the beginning of meiosis, Required for the leptotene-zygotene transition
MDAEMAAPALAAAHLLDSPMRPQVSRYYSKKRGSSHSRNGKDDANHDESKNQSPGLPLSR
QSLSSSATHTYHTGGFYEIDHEKLPPKSPIHLKSIRVVKVSGYTSLDVTVSFPSLLALRS
FFSSSPRSCTGPELDERFVMSSNHAARILRRRVAEEELAGDVMHQDSFWLVKPCLYDFSA
SSPHDVLTPSPPPATAQAKAPAASSCLLDTLKCDGAGWGVRRRVRYIGRHHDASKEASAA
SLDGYNTEVSVQEEQQQRLRLRLRLRQRREQEDNKSTSNGKRKREEAESSMDKSRAARKK
KAKTYKSPKKVEKRRVVEAKDGDPRRGKDRWSAERYAAAERSLLDIMRSHGACFGAPVMR
QALREEARKHIGDTGLLDHLLKHMAGRVPEGSADRFRRRHNADGAMEYWLEPAELAEVRR
LAGVSDPYWVPPPGWKPGDDVSAVAGDLLVKKKVEELAEEVDGVKRHIEQLSSNLVQLEK
ETKSEAERSYSSRKEKYQKLMKANEKLEKQVLSMKDMYEHLVQKKGKLKKEVLSLKDKYK
LVLEKNDKLEEQMASLSSSFLSLKEQLLLPRNGDNLNMERERVEVTLGKQEGLVPGEPLY
VDGGDRISQQADATVVQVGEKRTARKSSFRICKPQGTFMWPHMASGTSMAISGGGSSSCP
VASGPEQLPRSSSCPSIGPGGLPPSSRAPAEVVVASPLDEHVAFRGGFNTPPSASSTNAA
AAAKLPPLPSPTSPLQTRALFAAGFTVPALHNFSGLTLRHVDSSSPSSAPCGAREKMVTL
FDGDCRGISVVGTELALATPSYC*

5'UTR

chr03:25234081..25234150 (+ strand) : 70 bp

chr03:25234465..25234482 (+ strand) : 18 bp

CDS

chr03:25234483..25234542 (+ strand) : 60 bp

chr03:25235919..25236078 (+ strand) : 160 bp

chr03:25236203..25236279 (+ strand) : 77 bp

chr03:25236411..25237510 (+ strand) : 1100 bp

chr03:25237624..25237708 (+ strand) : 85 bp

chr03:25238155..25238217 (+ strand) : 63 bp

chr03:25238386..25238448 (+ strand) : 63 bp

chr03:25238647..25238730 (+ strand) : 84 bp

chr03:25238817..25239407 (+ strand) : 591 bp

chr03:25239622..25239750 (+ strand) : 129 bp

3'UTR

chr03:25239751..25240155 (+ strand) : 405 bp

FASTA

>Os03t0650400-02 class=Sequence position=chr03:25234081..25240155 (+ strand)
gtcgtctcct ccgctccttg cgccatctcg cggccgaaca ggggagagga ggggagggga tcctggtgag gtgagcatcc
gcatcctctt tctcatccat ctctctctcc ccacttctct ctggaatttg ctcgcgtttc tcttctagat ctggaagaag
ctcttctctc ttcatttcac agccttaacc ttactcctcc caagtagtag tagcagtttg cttgcttgtt tgttccccca
aaaagtttgA TCCGCCCCTG GCTCCTGTGA ATTTATTCGA TCGCTTCAAT GTGTGCGGAT GTGCCCGTGC TGTGGCTGTG
AGATCGATGG ATCAATCTCT GGATTAATTT TGCTTTTGCT TTTTTTGTTC TTTTGGGGAC GAAGGTCTCT GACGCGGAGC
ACATGGACGC GGAGATGGCG GCTCCTGCGC TTGCGGCAGC TCATCTGCTG GACTCGCCCA TGGTACAGAC GCGCATCTTC
GCTGACACTT CTTTCCTTGC GCCTTTTTTT TTTCAATTTC CATCTCCTCG CCTGGTTAGT TTCATTTCAT TGATCGCATA
TGCTCAGTGT GTACGAGTTG CTTTTGCTGA TTAAAATTCG ATCGGTGGGG GTGAGTGTTT GGGGGGTTTA GATGGTTTGC
TATTTGGATG CAGTTGCATG GTTGTGTGGA TTTCTCTACC AATGAATGTC TTAGTAGTAA TTGGATCAGT ACACTTAATG
CAGCTGATGG ATTGAATCAA TTTGGGTGGT TTGTTGTGTA ATTACTAGCG ATTGCGATGC ATGTGTGGCG AAATTAGTGG
GCTCAATCCA TAGCTTAGTA GTAGAATCCA AGACTTGGAA TTTCATGCAA AGATCCCTAT TAGGCTTGTT AATCAATCTC
TACATGTTGA TGTTACGTTC TTTGGAACCG CACTTGTGGC GTACTATTTC CAGTCAATTT ATTTTGCCTG CTGCCTGTTG
CGAGTACAAC CAGAAATTGC TGATTTTAGT GGACATGTCA TAGATGGAAC TATATGTGTC TTGCATGTTT CTAATGTTAC
TCATGCACGA TAAGTGGTTT TGTTAAGTGA AAGATGCAGT TGGGGTAATA TTAGTTCAAG TTGTTAATAA GTTGACAATG
CAGTGATGCA CGCTCTTTTC GTTTGGTACG ATGTCCGGTT AATATGGTAT ATCTTGAAGA TTAATTTGCA TGTTCTAATT
AACCAAAGGG CTTAAAATTT GACATGTTTC AGTTGTCCAA CTAAACTGGA GATAGATACA CGCGTCATTG AGTTTTCTTT
TACTGATTAG GCGATTACTT TCTGAAAACC ATATGTTTTG ACCAACTTGC TGTCATAGTT TTTTTTTTTT AACCTCATGG
AGTGATAGAA TTAGCAATAA TGAACTTTAG TTCCTATATA TGTTTAAGGT TCCATATACT TGCATGCATG TGCAATTTAC
TGACACTAGT GCTGTTAAGT TCAGTTAACA TCAGCAGCTA ATTAGTCTGG GCAGTGTCAC AGAAAAAAAA ATCTTAAAGC
AATACTAGAT CACAGACTCA CAGCTAGTAA TTCGGTTCAC ACATATGGAT CACTTTGTCA GGAAATCATG CATGCACAGA
AAAATTGCTC CCCTGTGTTT ATTTTGCTTC TAGGTACAGT ACAGAGTGGT ACGTGATGTT AATTGGTGTC TCTCTTCCAC
AAGGCTAGAG GTTTAATTCC ATCTCACGCA CGCTGCACGC GCACCCTCTA TCCCAAGCTT TCCCGTTTCA GTATCTCTGA
TCGCTCACTG CACCTGCATT ACACGAGCCA AAACGCCTGA CCTGTGCTTT GCATGTGTTG TGTTGGCCCA TTTCCAAGAG
GCCACAGGTG AGCAGATACT ACTCCAAGAA GAGGGGTAGC AGCCACAGCA GAAATGGCAA GGATGATGCC AACCATGACG
AGTCCAAGAA CCAATCACCC GGCTTGCCCC TGAGCAGACA GAGCCTGTCC TCATCTGCCA CCCACACCTA CCACACCGGT
GAGCAGAGCA ATGCCTCCAG GCTTTGAACT CTATCGTCTA GTTTATATTT GTGCAAGAGC AGTTCCCCCA ACTCTGTTTG
TGCCAAGTTC TTGAAAACCT GTGCTGTTTT TGGTTTGATC AGGAGGGTTC TACGAGATCG ACCACGAGAA GCTTCCCCCC
AAATCCCCAA TTCATCTCAA GTCCATACGC GTGGTAAAGG TGAGCCTTTT TTTTTCTTAC TCGTACACTC GACTGCTAGC
TTTGATCTGG ATTGATTTGA TGAATTGTTC TCGAAATGTT TGATCTGGAT TGCTTCTCGC TCGTGGTGTT GTGGTCTTTG
GTGGGTGCAG GTGAGCGGCT ACACAAGCCT GGACGTCACA GTGAGCTTCC CGTCCCTCCT GGCGCTGCGA AGCTTCTTCT
CCTCCTCCCC ACGGTCGTGC ACTGGGCCGG AGCTCGACGA GCGCTTCGTC ATGAGCAGCA ACCACGCGGC CCGCATCCTG
CGCCGTCGGG TGGCCGAGGA GGAGCTCGCG GGCGACGTGA TGCACCAGGA CAGCTTCTGG CTCGTCAAGC CCTGCCTCTA
TGACTTCTCC GCGTCGTCAC CACATGATGT GCTGACCCCG TCGCCGCCGC CTGCCACAGC GCAGGCGAAG GCGCCGGCAG
CCAGTTCCTG CCTTCTCGAC ACCTTGAAGT GCGACGGCGC CGGGTGGGGC GTGAGGCGCC GTGTCAGGTA CATTGGTCGC
CACCACGATG CTTCCAAGGA GGCCAGCGCT GCCAGCCTCG ATGGCTACAA CACAGAGGTC AGCGTCCAGG AGGAGCAGCA
GCAGCGACTG CGGCTTCGAC TGCGGTTGCG ACAACGCCGG GAGCAGGAAG ACAACAAGAG CACTAGCAAT GGCAAGAGGA
AGCGGGAGGA GGCAGAGAGC AGCATGGACA AGAGCAGAGC CGCCAGGAAG AAGAAAGCCA AGACTTACAA GAGTCCCAAG
AAGGTGGAGA AGAGGCGCGT CGTGGAGGCT AAAGACGGCG ACCCTCGGCG CGGCAAGGAC CGGTGGTCGG CCGAGCGGTA
CGCAGCGGCG GAGAGGAGCC TGCTGGATAT AATGCGCTCC CATGGTGCCT GCTTCGGTGC GCCGGTGATG CGGCAGGCTC
TGCGGGAGGA AGCCCGCAAG CATATCGGTG ACACCGGCCT CCTTGACCAC CTGCTCAAGC ACATGGCCGG CAGGGTACCG
GAAGGCAGCG CGGACCGGTT CCGTCGCCGG CACAATGCGG ATGGTGCCAT GGAGTACTGG CTGGAGCCGG CGGAGCTTGC
CGAGGTACGG CGGCTGGCTG GAGTGTCTGA TCCATACTGG GTGCCGCCAC CTGGGTGGAA GCCAGGTGAT GACGTGTCCG
CAGTCGCCGG TGACCTCCTG GTCAAGAAGA AGGTGGAAGA GCTCGCTGAG GAGGTTGATG GTGTAAAAAG GTCTCCTTTC
TCTCGCTTTT TTGCAGCTTC TACTTCTTGT TTGGAGAAAT ACCAACATTT TTGTCAGTTC TACGAGTTCT GTGCTAAATT
TCACTTGGGC TGGTGGTGTG AAGGCACATC GAGCAGCTCA GTTCTAATTT GGTGCAGCTG GAGAAGGAAA CAAAATCTGA
GGCAGAGCGA TCTTACAGCT CTAGGAAGGT ATATAGCCCA TCAATCCTGT CGATTATTTC CCTTGCATCC ATTTTCCTTC
TGTTTATTGT TGTTACTTCT CAAGAAAGCG GGAATGTTTT TTTGTTTGCC CATTGTGACT TAAAATGTAA CAAGCTAATA
TAACACTTGA GTTGCATTGA CCTGCTTGCC TGTATTTTGA GTTGCATTGA CCTGCCTGCC TATATTTTGA AATCTAGTCC
TTTTATTTGT TTTTTCAGAA TTTCCATGTA GGTATTATCA GTAGTTATGG CAATTGGCAA TCTGGTCTTT TTCAATCTCT
GAAAGTGTAA ATTGTGAAGG ACATATATGC AGCCAGCTAA AATTTCTCAG CTTTACTTAC ATTGACAAAA GCATACACTT
TTGGCATGCC TCTCTTCTGT TCTGCTCTGC TTTCCATTAT TGGAGCACTC Atttctttag catttgtttt tcaggagaag
tatcagaagt tgatgaaggc aaatgaaaAG CTCGAGAAAC AGGTGTTATC TATGAAGGTA ACTAAACAAC ACCTCTCATC
CTACTCCTGC GCTTTCATCT CAAACTATGC AAAAGCACTG GTACCTTGTT TAGCAACAAA TGATCCACGT CTCTGATCAT
GTTCGATTAT ATGCCTGCAC TTACATTAAG GTAAAACACA TATCATTTCC TTGTTTAAAT TACAGGACAT GTATGAGCAT
CTGGTTCAGA AAAAGGGTAA GCTGAAGAAG GAGGTGCTGT CCTTGAAGGT ATACCCCTGC AGATACACCT GAAATTTCCA
CCATGATCTG CACTTCACCA CACATTATGA TTTTCAAGCA AACTAAGCAG TTATACTCCT TGGGACTATT TTACTTTGGT
CCACCATGTT TCTGATTATT CTGTTGTACC TAGCTATTTG CATGTTTAAT TATACAACTC TTGATCATCA ACTGGTACCT
TTTCAGGATA AATACAAGCT TGTGCTGGAG AAGAATGATA AACTGGAGGA ACAGATGGCT AGTCTCTCCA GCTCCTTCCT
TTCTTTGAAG GTTGGTTGCC CTTTGTGGGT TCTGCTTCTA ATTGTACCTG AAACACATGC CTTATTCCAA ATCACCTGAC
ACCTCTGCAT GCACAGGAAC AATTGCTGCT GCCAAGAAAT GGAGATAATC TGAACATGGA AAGGGAAAGG GTGGAAGTGA
CTTTGGGCAA GCAAGAAGGC CTTGTTCCCG GCGAACCACT GTATGTTGAT GGTGGTGACC GGATCAGCCA GCAAGCAGAT
GCCACCGTCG TCCAAGTCGG CGAGAAGAGG ACGGCGAGGA AGAGCAGCTT CCGCATCTGC AAGCCACAGG GAACGTTCAT
GTGGCCACAC ATGGCGTCTG GCACGAGCAT GGCCATCAGT GGGGGAGGCA GCAGCAGCTG CCCTGTCGCC TCCGGGCCAG
AGCAGCTCCC TCGCAGCAGC AGCTGCCCCA GCATTGGGCC TGGTGGCCTC CCGCCGTCGT CACGAGCCCC AGCCGAGGTG
GTGGTCGCGT CGCCACTGGA CGAGCACGTG GCGTTCCGCG GGGGCTTCAA CACGCCGCCC TCGGCATCGT CCACCAACGC
CGCCGCTGCC GCCAAGCTGC CTCCCCTGCC CAGCCCGACG TCACCTCTCC AGACACGGGC CCTGTTCGCC GCTGGCTTCA
CTGTCCCGGC ATTACACAAC TTCTCCGGCC TCACCTTACG CCATGTGGTA AGTTCAAACA TCTGCATCCG CACTTTGATT
TCAACTCCCA ACTCCTCCCA AGAACTGGAA TTCCTTGAGC CTGTCAGATG CAAGATGGAC GGCTTGGATG ACCAACCAGT
CACCCACAGA GAACACTTCT CTTCCCTTCT CTTTCTTCAA CATGTGACAC CTGACACTGA TAATCTCGTA TTCATGGCTG
GCTGTTCGTC TGTCTGTGCA GGACTCCTCG TCGCCGTCGT CCGCGCCATG CGGTGCTAGG GAGAAGATGG TGACCCTGTT
CGATGGAGAC TGCCGGGGGA TCAGCGTCGT GGGCACCGAG CTGGCACTGG CCACTCCGTC CTACTGCTGA TCAAGTTCTT
CCCTCCCCTT CTGCTTCGCC ACCCGCCCCC ATAATTAATT AATTAATCAC GGAACCAAAA GATTTATTCT AGTTTAAGGT
AGAGAAATGA TAACATAAGA AGACAATAAC AACACACACA CACACACACA AAAATATAAG ATAGAAGAGG AAGAGTTATT
TTTCTCGGTT ACAAACTCAA AGTTGCAGTT TAGAACTTGG TAAGTAGATG TTTCAGGCTG GTTGGTCAGT TAATGGTTTG
AGTCCCCATG TCTGTACTGA TCGATGTAAG CCTGACAAAT TTTGGTAGGC TGATACTCTC CCTAGCCCTT CGCGTGACAC
ATTCGAAGTG GAATGTGTCC AGTTTTCTGA CGGGCTAGGT CCGCTATTTT GTCCTGGATA CATATTCATT ATTCA

Locus: Os03g0650400

Loading...

Locus: Os03g0650400

Loading...