Os03t0656500-01

Locus

Os03g0656500

Description

Node-expressed Cd transporter, Putative cation/calcium (Ca) exchanger, Cd accumulation in the grain

RAP-DB Gene Symbol Synonym(s)

OsCCX2

RAP-DB Gene Name Synonym(s)

cation/calcium (Ca) exchanger 2

CGSNL Gene Symbol

CDT1

CGSNL Gene Name

CADMIUM TOLERANT 1

Oryzabase Gene Symbol Synonym(s)

OsCDT1, OsCCX2, CCX2, OsNCX8, NCX8

Oryzabase Gene Name Synonym(s)

sativa DcCDT1 homologue 1, cation/Ca2+ exchanger 2, cadmium tolerance 1, Na+/Ca2+ Exchanger 8, Sodium/calcium exchanger 8

Transcript Evidence

AK121052

Protein Evidence

Q7Y0B2

Literature

PMID: 29696032

Note

Manual Curation

May 1, 2018

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

Sodium/calcium exchanger membrane region (IPR004837)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

J023055H11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0656500-01)

RiceXPro (AK121052)

Others

Oryzabase (8298)

KEGG (Os03t0656500-01)

Transcript

2355 bp

>Os03t0656500-01 Node-expressed Cd transporter, Putative cation/calcium (Ca) exchanger, Cd accumulation in the grain
ATTCCGCTTCCTCGGCGCCCGTACGTGCCACCACCGCGTGCCCAACTTGCAAGGTTACTT
AACCCACAAGGGTGTGTTCGCTCTCTCTCTCTCTATCGCTCTCTCGCTCGCGTCGCGTCT
CCTCGCCTCCCGTCCCACTCGCTCTGTTCGCGCGGTACACGCACGCACTACGCACACGGA
CACGCCTCGCGCTGATGAGCTGAGGTGAGCTCGCCCACCGCCCGCGCCGCGAATCCCTCC
GCGCCGCTCCGCCTCCACGCCGAGATCCCCCGCGCGCAAACGCCCCCACCCCACCTCCGA
TCCCCCCCTGCGGGCCGCATGCCGTCCTAGGAATCCCCCGCGTTCTCCCCCGTTTTATGG
CGCTCCTGCGCAGGCGGGGGTACAGTGCCGCCGTCCCCAGCGCCTGCTGCTTCCTCCTCC
TGCTGCTCGTCCTCTCCGCCTCCCACCTCCTGCCCACTCGCCGAGGCCATGGCGGCGTCC
TAGAAGGGTTGGCCCTTAGGGGGAGCGCCTCTCGTTCTCGTTCTGGTTCGTCGTCGTCCT
CTTCCGCCGGCGAGGAGCAGGGAAGTTGCCAGGAGCTGCAGTCCATCGAGGGCGGGGAGG
CCAGGTGCCTGTACCTCCGGACGCACCCGCCGTGCGCGCCCGCGGGGTACGTGGACTACC
TCAGGCTGTTCTACTGCGGGTTCGCCCACGCGCCGGCGGCGGGGTACGCCGCGGCCGTGC
TCTGGCTGGCGGTGCTCTTCTACCTGCTCGGCGACACCGCGTCCGAGTACTTCTGCGCGT
CCCTCGAGGGGCTCTCGGCGGAGCTGCGCCTGCCGCCGGCCATCGCTGGCGTCACGCTGC
TCTCGCTCGGGAACGGCGCGCCGGATGTCTTCGCCAGCGTCGTCTCCTTCGCGGCCGGCG
ACGGCGGGGGCGTCGGGCTCAACAGCGCGCTCGGTGGCGCGCTGTTCGTGTCCACCGTTG
TTGCTGGGGTGGTCGCGCTCGCCGCCGCCTCGCGTGCCGGCCGAGGCGGGGTTGTGGTGG
AGCTGCGGGGATTCGTGCGCGACATCTGCTTCCTCCTCCTCGCGCTCTGCTCACTCCTCG
CCATACTGGTGACCGGCACGGTCACCGTCTGGGTGTCCGCGTCCTTCGTCTCGCTCTATG
TCGCGTATGTCCTCCTCGTCTGGACCTCCCACTGCTGCTCTGAACCGGGGAAGCCGCCGC
AGGCCGACCTCGCCGCGCCGCTCCTCCTCGACGACGACGGCGGCGTCACGCCACTGCCGT
CCTACTCCAAGAACTCGGCGCCCTCGAAAAAAAGAGCCTACCTTCATTGCCTCCTATCCG
CGATCCTCATCCCGCTGTACCTCCCTCGCCGCCTGACAATCCCGGACATCGCCGGGCACC
GCTGGTCCCGGCCCTGCGCCGTGGCGTCCCTCGCTCTGGCGCCGGTCCTCCTCGCCGCCA
CCTGGGCATCGTCGTGCCGGCATGCCCTCGCCGTCCTCCTCGGCGGCGCCCTCCTCGGCC
TCCTCCTCGCCGCGCTCGCCGCGGCCACCACGGAGGCGGCCTCCCCACCCCGCGGGCGGT
GGCGGCGCGTGCCGTGGCTGGCGGCGGGGTTCCTGATGAGCGTGCTGTGGGCGTACACCC
TGGCGCGCGAGCTGGTGGCGCTGCTGGTGGCGATCGGGTACATGGTGGGCGTGAGGGCGA
GCGTGCTGGGCGTGACGGTGCTGGCGTGGGGGGACTCGCTGGGCGACCTGGTGTCGAACG
TCGCCATGGCGCTGCACGGCGGCGCCGGCGGCGCGCAGACGGCGGTGTCGGGCTGCTACG
CGGGCCCGCTGTTCAACACGGTGGTGGGGCTGGGCCTCTCGCTGACGCTGGCGGCGGGGT
CCCAGTACCCGGCGCCGTTCGCGATCCCGGCGGGCGGGGCGGTGTACGAGGCGGTGGGGT
TCCTCGGCGCCGGGCTGGCATGGGCGCTGCTGGTGGTGCCGGCGAGGGGGATGCGGCTGG
ACCGGGTGTACGGCATGGGCCTCATCGCCATCTACCTCGCCTTCGTCACCATCCGCGTCT
TCGACAGCCTCGGCCTCTGGACACACTCCTGGTGGCCAGCATAGCAACACCCCCCACCTA
GCGATCGATATGATCGAGCAGTTGCAACCAAACCTATCGCTGCTCTCGGAGCGCCATCAA
TGGCGACCACTGATTGATTGTAGAACGTAGCCACGTACTACACCTAGCTTTGTGCTAGCA
GCCTAGTAACATCGACTGATAGATCAAAAACCAGATTTTTGTGTATATTACTCACAAGCC
TTTAGCTAACAGCGATGTAGCAATTGTTCATATATCTTCGTTTGGCATCCTGTCGCAATC
CCGACATTAACGAGC

CDS

1728 bp

>Os03t0656500-01 Node-expressed Cd transporter, Putative cation/calcium (Ca) exchanger, Cd accumulation in the grain
ATGGCGCTCCTGCGCAGGCGGGGGTACAGTGCCGCCGTCCCCAGCGCCTGCTGCTTCCTC
CTCCTGCTGCTCGTCCTCTCCGCCTCCCACCTCCTGCCCACTCGCCGAGGCCATGGCGGC
GTCCTAGAAGGGTTGGCCCTTAGGGGGAGCGCCTCTCGTTCTCGTTCTGGTTCGTCGTCG
TCCTCTTCCGCCGGCGAGGAGCAGGGAAGTTGCCAGGAGCTGCAGTCCATCGAGGGCGGG
GAGGCCAGGTGCCTGTACCTCCGGACGCACCCGCCGTGCGCGCCCGCGGGGTACGTGGAC
TACCTCAGGCTGTTCTACTGCGGGTTCGCCCACGCGCCGGCGGCGGGGTACGCCGCGGCC
GTGCTCTGGCTGGCGGTGCTCTTCTACCTGCTCGGCGACACCGCGTCCGAGTACTTCTGC
GCGTCCCTCGAGGGGCTCTCGGCGGAGCTGCGCCTGCCGCCGGCCATCGCTGGCGTCACG
CTGCTCTCGCTCGGGAACGGCGCGCCGGATGTCTTCGCCAGCGTCGTCTCCTTCGCGGCC
GGCGACGGCGGGGGCGTCGGGCTCAACAGCGCGCTCGGTGGCGCGCTGTTCGTGTCCACC
GTTGTTGCTGGGGTGGTCGCGCTCGCCGCCGCCTCGCGTGCCGGCCGAGGCGGGGTTGTG
GTGGAGCTGCGGGGATTCGTGCGCGACATCTGCTTCCTCCTCCTCGCGCTCTGCTCACTC
CTCGCCATACTGGTGACCGGCACGGTCACCGTCTGGGTGTCCGCGTCCTTCGTCTCGCTC
TATGTCGCGTATGTCCTCCTCGTCTGGACCTCCCACTGCTGCTCTGAACCGGGGAAGCCG
CCGCAGGCCGACCTCGCCGCGCCGCTCCTCCTCGACGACGACGGCGGCGTCACGCCACTG
CCGTCCTACTCCAAGAACTCGGCGCCCTCGAAAAAAAGAGCCTACCTTCATTGCCTCCTA
TCCGCGATCCTCATCCCGCTGTACCTCCCTCGCCGCCTGACAATCCCGGACATCGCCGGG
CACCGCTGGTCCCGGCCCTGCGCCGTGGCGTCCCTCGCTCTGGCGCCGGTCCTCCTCGCC
GCCACCTGGGCATCGTCGTGCCGGCATGCCCTCGCCGTCCTCCTCGGCGGCGCCCTCCTC
GGCCTCCTCCTCGCCGCGCTCGCCGCGGCCACCACGGAGGCGGCCTCCCCACCCCGCGGG
CGGTGGCGGCGCGTGCCGTGGCTGGCGGCGGGGTTCCTGATGAGCGTGCTGTGGGCGTAC
ACCCTGGCGCGCGAGCTGGTGGCGCTGCTGGTGGCGATCGGGTACATGGTGGGCGTGAGG
GCGAGCGTGCTGGGCGTGACGGTGCTGGCGTGGGGGGACTCGCTGGGCGACCTGGTGTCG
AACGTCGCCATGGCGCTGCACGGCGGCGCCGGCGGCGCGCAGACGGCGGTGTCGGGCTGC
TACGCGGGCCCGCTGTTCAACACGGTGGTGGGGCTGGGCCTCTCGCTGACGCTGGCGGCG
GGGTCCCAGTACCCGGCGCCGTTCGCGATCCCGGCGGGCGGGGCGGTGTACGAGGCGGTG
GGGTTCCTCGGCGCCGGGCTGGCATGGGCGCTGCTGGTGGTGCCGGCGAGGGGGATGCGG
CTGGACCGGGTGTACGGCATGGGCCTCATCGCCATCTACCTCGCCTTCGTCACCATCCGC
GTCTTCGACAGCCTCGGCCTCTGGACACACTCCTGGTGGCCAGCATAG

Protein

576 aa

>Os03t0656500-01 Node-expressed Cd transporter, Putative cation/calcium (Ca) exchanger, Cd accumulation in the grain
MALLRRRGYSAAVPSACCFLLLLLVLSASHLLPTRRGHGGVLEGLALRGSASRSRSGSSS
SSSAGEEQGSCQELQSIEGGEARCLYLRTHPPCAPAGYVDYLRLFYCGFAHAPAAGYAAA
VLWLAVLFYLLGDTASEYFCASLEGLSAELRLPPAIAGVTLLSLGNGAPDVFASVVSFAA
GDGGGVGLNSALGGALFVSTVVAGVVALAAASRAGRGGVVVELRGFVRDICFLLLALCSL
LAILVTGTVTVWVSASFVSLYVAYVLLVWTSHCCSEPGKPPQADLAAPLLLDDDGGVTPL
PSYSKNSAPSKKRAYLHCLLSAILIPLYLPRRLTIPDIAGHRWSRPCAVASLALAPVLLA
ATWASSCRHALAVLLGGALLGLLLAALAAATTEAASPPRGRWRRVPWLAAGFLMSVLWAY
TLARELVALLVAIGYMVGVRASVLGVTVLAWGDSLGDLVSNVAMALHGGAGGAQTAVSGC
YAGPLFNTVVGLGLSLTLAAGSQYPAPFAIPAGGAVYEAVGFLGAGLAWALLVVPARGMR
LDRVYGMGLIAIYLAFVTIRVFDSLGLWTHSWWPA*

5'UTR

chr03:25613825..25614180 (+ strand) : 356 bp

CDS

chr03:25614181..25615908 (+ strand) : 1728 bp

3'UTR

chr03:25615909..25616179 (+ strand) : 271 bp

FASTA

>Os03t0656500-01 class=Sequence position=chr03:25613825..25616179 (+ strand)
ATTCCGCTTC CTCGGCGCCC GTACGTGCCA CCACCGCGTG CCCAACTTGC AAGGTTACTT AACCCACAAG GGTGTGTTCG
CTCTCTCTCT CTCTATCGCT CTCTCGCTCG CGTCGCGTCT CCTCGCCTCC CGTCCCACTC GCTCTGTTCG CGCGGTACAC
GCACGCACTA CGCACACGGA CACGCCTCGC GCTGATGAGC TGAGGTGAGC TCGCCCACCG CCCGCGCCGC GAATCCCTCC
GCGCCGCTCC GCCTCCACGC CGAGATCCCC CGCGCGCAAA CGCCCCCACC CCACCTCCGA TCCCCCCCTG CGGGCCGCAT
GCCGTCCTAG GAATCCCCCG CGTTCTCCCC CGTTTTATGG CGCTCCTGCG CAGGCGGGGG TACAGTGCCG CCGTCCCCAG
CGCCTGCTGC TTCCTCCTCC TGCTGCTCGT CCTCTCCGCC TCCCACCTCC TGCCCACTCG CCGAGGCCAT GGCGGCGTCC
TAGAAGGGTT GGCCCTTAGG GGGAGCGCCT CTCGTTCTCG TTCTGGTTCG TCGTCGTCCT CTTCCGCCGG CGAGGAGCAG
GGAAGTTGCC AGGAGCTGCA GTCCATCGAG GGCGGGGAGG CCAGGTGCCT GTACCTCCGG ACGCACCCGC CGTGCGCGCC
CGCGGGGTAC GTGGACTACC TCAGGCTGTT CTACTGCGGG TTCGCCCACG CGCCGGCGGC GGGGTACGCC GCGGCCGTGC
TCTGGCTGGC GGTGCTCTTC TACCTGCTCG GCGACACCGC GTCCGAGTAC TTCTGCGCGT CCCTCGAGGG GCTCTCGGCG
GAGCTGCGCC TGCCGCCGGC CATCGCTGGC GTCACGCTGC TCTCGCTCGG GAACGGCGCG CCGGATGTCT TCGCCAGCGT
CGTCTCCTTC GCGGCCGGCG ACGGCGGGGG CGTCGGGCTC AACAGCGCGC TCGGTGGCGC GCTGTTCGTG TCCACCGTTG
TTGCTGGGGT GGTCGCGCTC GCCGCCGCCT CGCGTGCCGG CCGAGGCGGG GTTGTGGTGG AGCTGCGGGG ATTCGTGCGC
GACATCTGCT TCCTCCTCCT CGCGCTCTGC TCACTCCTCG CCATACTGGT GACCGGCACG GTCACCGTCT GGGTGTCCGC
GTCCTTCGTC TCGCTCTATG TCGCGTATGT CCTCCTCGTC TGGACCTCCC ACTGCTGCTC TGAACCGGGG AAGCCGCCGC
AGGCCGACCT CGCCGCGCCG CTCCTCCTCG ACGACGACGG CGGCGTCACG CCACTGCCGT CCTACTCCAA GAACTCGGCG
CCCTCGAAAA AAAGAGCCTA CCTTCATTGC CTCCTATCCG CGATCCTCAT CCCGCTGTAC CTCCCTCGCC GCCTGACAAT
CCCGGACATC GCCGGGCACC GCTGGTCCCG GCCCTGCGCC GTGGCGTCCC TCGCTCTGGC GCCGGTCCTC CTCGCCGCCA
CCTGGGCATC GTCGTGCCGG CATGCCCTCG CCGTCCTCCT CGGCGGCGCC CTCCTCGGCC TCCTCCTCGC CGCGCTCGCC
GCGGCCACCA CGGAGGCGGC CTCCCCACCC CGCGGGCGGT GGCGGCGCGT GCCGTGGCTG GCGGCGGGGT TCCTGATGAG
CGTGCTGTGG GCGTACACCC TGGCGCGCGA GCTGGTGGCG CTGCTGGTGG CGATCGGGTA CATGGTGGGC GTGAGGGCGA
GCGTGCTGGG CGTGACGGTG CTGGCGTGGG GGGACTCGCT GGGCGACCTG GTGTCGAACG TCGCCATGGC GCTGCACGGC
GGCGCCGGCG GCGCGCAGAC GGCGGTGTCG GGCTGCTACG CGGGCCCGCT GTTCAACACG GTGGTGGGGC TGGGCCTCTC
GCTGACGCTG GCGGCGGGGT CCCAGTACCC GGCGCCGTTC GCGATCCCGG CGGGCGGGGC GGTGTACGAG GCGGTGGGGT
TCCTCGGCGC CGGGCTGGCA TGGGCGCTGC TGGTGGTGCC GGCGAGGGGG ATGCGGCTGG ACCGGGTGTA CGGCATGGGC
CTCATCGCCA TCTACCTCGC CTTCGTCACC ATCCGCGTCT TCGACAGCCT CGGCCTCTGG ACACACTCCT GGTGGCCAGC
ATAGCAACAC CCCCCACCTA GCGATCGATA TGATCGAGCA GTTGCAACCA AACCTATCGC TGCTCTCGGA GCGCCATCAA
TGGCGACCAC TGATTGATTG TAGAACGTAG CCACGTACTA CACCTAGCTT TGTGCTAGCA GCCTAGTAAC ATCGACTGAT
AGATCAAAAA CCAGATTTTT GTGTATATTA CTCACAAGCC TTTAGCTAAC AGCGATGTAG CAATTGTTCA TATATCTTCG
TTTGGCATCC TGTCGCAATC CCGACATTAA CGAGC

Locus: Os03g0656500

Loading...

Locus: Os03g0656500

Loading...