Os03t0661300-01

Locus

Os03g0661300

Description

Beta-tubulin , Microtubules formation

RAP-DB Gene Symbol Synonym(s)

TUB8, OsTUB8, TUBB8

RAP-DB Gene Name Synonym(s)

BETA TUBULIN 8, beta tubulin 8, Tubulin beta-8 chain, Beta-8-tubulin

CGSNL Gene Symbol

TUB8

CGSNL Gene Name

BETA TUBULIN 8

Oryzabase Gene Symbol Synonym(s)

OsTUB8, TUBB8

Oryzabase Gene Name Synonym(s)

beta tubulin 8, Tubulin beta-8 chain, Beta-8-tubulin

Transcript Evidence

AB104733

AK121321

Protein Evidence

Q76FS2

Q10FN6

Literature

PMID: 14634157

Note

Manual Curation

February 8, 2010

Gene Ontology (GO)

Biological Process: microtubule-based process (GO:0007017)

Biological Process: protein polymerization (GO:0051258)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: structural constituent of cytoskeleton (GO:0005200)

Molecular Function: GTP binding (GO:0005525)

Cellular Component: microtubule (GO:0005874)

Cellular Component: protein complex (GO:0043234)

Functional domain (InterPro)

Tubulin (IPR000217)

Beta tubulin (IPR002453)

Tubulin/FtsZ, GTPase domain (IPR003008)

Tubulin/FtsZ, C-terminal (IPR008280)

Tubulin/FtsZ, 2-layer sandwich domain (IPR018316)

Tubulin, C-terminal (IPR023123)

Beta tubulin, autoregulation binding site (IPR013838)

Tubulin, conserved site (IPR017975)

Full-length cDNA

J023114E06 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0661300-01)

RiceXPro (AK121321)

Others

Oryzabase (2963)

KEGG (Os03t0661300-01)

Transcript

1739 bp

>Os03t0661300-01 Beta-tubulin , Microtubules formation
ACGTTCTCCACCCTCTCTCCATCGATCGATCGCAAACCACCTCCCAAGAACAACCAAGAA
AGAGATCGGATCACCGATCGGCGCGCGGCGAGCGATCGATCGAGGTGCAAGCGATCGAAG
ATGAGGGAGATCCTGCACATCCAGGGCGGGCAGTGCGGCAACCAGATCGGCGCCAAGTTC
TGGGAGGTGATCTGCGGCGAGCACGGCGTCGACCccacggggacgtacaccggcacgtcg
ccgcagcagctcgagcggatcaacgtctacttcaacgaggcgagcggcggccgccacgtc
ccgcgcgccgtgctcatggacctcgagccgggcaccatggactcgctccgctccggcccc
atcggcggcatcttccgccCCGACAACTTCGTCTTCGGCCAGTCCGGCGCCGGCAACAAC
TGGGCCAAGGGCCACTACACCGAGGGCGCCGAGCTCATCGACTCCGTCCTCGACGTCGTC
CGCAAGGAGGCCGAGAACTGCGACTGCCTCCAAGGATTCCAGGTGTGCCACTCGCTGGGA
GGAGGCACGGGGTCGGGCATGGGCACGCTGCTCATCTCCAAGATCAGGGAGGAGTACCCG
GACCGCATGATGCTGACCTTCTCCGTGTTCCCGTCGCCCAAGGTGTCGGACACCGTGGTG
GAGCCCTACAACGCGACGCTGTCCGTGCACCAGCTCGTCGAGAACGCCGACGAGTGCATG
GTCCTCGACAACGAGGCCCTCTACGACATCTGCTTCCGCACCCTCAAGCTCACCAACCCA
TCATTTGGTGACCTGAACCACCTGATATCGGCGACGATGAGCGGGGTGACGTGCTGCCTG
CGGTTCCCGGGGCAGCTGAACTCGGACCTGAGGAAGCTGGCGGTGAACCTGATCCCGTTC
CCGCGGCTGCACTTCTTCATGGTGGGGTTCGCGCCGCTGACGTCGCGCGGGTCGCAGCAG
TACAGGGCGCTGACGGTGCCGGAGCTGACGCAGCagatgtgggacgccaagaacatgatg
tgcgccgccgacccgcgccacggccgctacctcacggcgtccgccatgttccggggcagg
atgagcaccaaggaggtggacgagcagatgatcaacgtgcagaacaagaaCTCGTCCTAC
TTCGTGGAGTGGATCCCCAACAACGTCAAGTCCAGCGTCTGCGACATCCCCCCCGTCGGC
CTCTCCATGGCGTCCACCTTCGTCGGCAACTCCACCTCCATCCAGGAGATGTTCCGCCGC
GTCAGCGAGCAGTTCACCGCCATGTTCCGCCGCAAGGCCTTCCTCCACTGGTACACCAGC
GAGGGAATGGACGAGATGGAGTTCACCGAGGCCGAGAGCAACATGAACGACCTCGTCGCC
GAGTACCAGCAGTACCAGGACGCCACCGCCGAGGACGACTACGACGAGGACGACGACGCC
GCCGCCGCCGACGAGGCCTGATCGATCGATCGATCGATCCCTCCCGCTTTGCCTCTCTGG
CTCTCTGCTACGCTACGCTACATATATTTCGATCGGTACAAACACACAATGTGCCGTTGC
CGTGTCTGCTGCTACTGCTGCTGCTTGTGTACTGTGCGCTACTACTTGTTGCATGCCTTC
GTTCGTTGTCATCGTTGTTCTCTGTCTAAATTTGTTTATTCATGTACATGAACCGTGGTT
TACTCTTTTCTATCTCTGTATATGTTAGGAAATGTTATCTACTTCATTTTCATGGGACT

CDS

1341 bp

>Os03t0661300-01 Beta-tubulin , Microtubules formation
ATGAGGGAGATCCTGCACATCCAGGGCGGGCAGTGCGGCAACCAGATCGGCGCCAAGTTC
TGGGAGGTGATCTGCGGCGAGCACGGCGTCGACCccacggggacgtacaccggcacgtcg
ccgcagcagctcgagcggatcaacgtctacttcaacgaggcgagcggcggccgccacgtc
ccgcgcgccgtgctcatggacctcgagccgggcaccatggactcgctccgctccggcccc
atcggcggcatcttccgccCCGACAACTTCGTCTTCGGCCAGTCCGGCGCCGGCAACAAC
TGGGCCAAGGGCCACTACACCGAGGGCGCCGAGCTCATCGACTCCGTCCTCGACGTCGTC
CGCAAGGAGGCCGAGAACTGCGACTGCCTCCAAGGATTCCAGGTGTGCCACTCGCTGGGA
GGAGGCACGGGGTCGGGCATGGGCACGCTGCTCATCTCCAAGATCAGGGAGGAGTACCCG
GACCGCATGATGCTGACCTTCTCCGTGTTCCCGTCGCCCAAGGTGTCGGACACCGTGGTG
GAGCCCTACAACGCGACGCTGTCCGTGCACCAGCTCGTCGAGAACGCCGACGAGTGCATG
GTCCTCGACAACGAGGCCCTCTACGACATCTGCTTCCGCACCCTCAAGCTCACCAACCCA
TCATTTGGTGACCTGAACCACCTGATATCGGCGACGATGAGCGGGGTGACGTGCTGCCTG
CGGTTCCCGGGGCAGCTGAACTCGGACCTGAGGAAGCTGGCGGTGAACCTGATCCCGTTC
CCGCGGCTGCACTTCTTCATGGTGGGGTTCGCGCCGCTGACGTCGCGCGGGTCGCAGCAG
TACAGGGCGCTGACGGTGCCGGAGCTGACGCAGCagatgtgggacgccaagaacatgatg
tgcgccgccgacccgcgccacggccgctacctcacggcgtccgccatgttccggggcagg
atgagcaccaaggaggtggacgagcagatgatcaacgtgcagaacaagaaCTCGTCCTAC
TTCGTGGAGTGGATCCCCAACAACGTCAAGTCCAGCGTCTGCGACATCCCCCCCGTCGGC
CTCTCCATGGCGTCCACCTTCGTCGGCAACTCCACCTCCATCCAGGAGATGTTCCGCCGC
GTCAGCGAGCAGTTCACCGCCATGTTCCGCCGCAAGGCCTTCCTCCACTGGTACACCAGC
GAGGGAATGGACGAGATGGAGTTCACCGAGGCCGAGAGCAACATGAACGACCTCGTCGCC
GAGTACCAGCAGTACCAGGACGCCACCGCCGAGGACGACTACGACGAGGACGACGACGCC
GCCGCCGCCGACGAGGCCTGA

Protein

447 aa

>Os03t0661300-01 Beta-tubulin , Microtubules formation
MREILHIQGGQCGNQIGAKFWEVICGEHGVDPTGTYTGTSPQQLERINVYFNEASGGRHV
PRAVLMDLEPGTMDSLRSGPIGGIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTNPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGRMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPVG
LSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTSEGMDEMEFTEAESNMNDLVA
EYQQYQDATAEDDYDEDDDAAAADEA*

5'UTR

chr03:25942767..25942886 (+ strand) : 120 bp

CDS

chr03:25942887..25943280 (+ strand) : 394 bp

chr03:25945370..25945639 (+ strand) : 270 bp

chr03:25945732..25946408 (+ strand) : 677 bp

3'UTR

chr03:25946409..25946686 (+ strand) : 278 bp

FASTA

>Os03t0661300-01 class=Sequence position=chr03:25942767..25946686 (+ strand)
ACGTTCTCCA CCCTCTCTCC ATCGATCGAT CGCAAACCAC CTCCCAAGAA CAACCAAGAA AGAGATCGGA TCACCGATCG
GCGCGCGGCG AGCGATCGAT CGAGGTGCAA GCGATCGAAG ATGAGGGAGA TCCTGCACAT CCAGGGCGGG CAGTGCGGCA
ACCAGATCGG CGCCAAGTTC TGGGAGGTGA TCTGCGGCGA GCACGGCGTC GACCccacgg ggacgtacac cggcacgtcg
ccgcagcagc tcgagcggat caacgtctac ttcaacgagg cgagcggcgg ccgccacgtc ccgcgcgccg tgctcatgga
cctcgagccg ggcaccatgg actcgctccg ctccggcccc atcggcggca tcttccgccC CGACAACTTC GTCTTCGGCC
AGTCCGGCGC CGGCAACAAC TGGGCCAAGG GCCACTACAC CGAGGGCGCC GAGCTCATCG ACTCCGTCCT CGACGTCGTC
CGCAAGGAGG CCGAGAACTG CGACTGCCTC CAAGGTAACG TACACGTCGA TTTTATATAT ACATATCCTC TTGTTCTTTA
AATTCACTGT GTTTCGTTAA AAAAAGAAAA AACGAATCCT TGCGTTCATG GCATTCCTCT GCATTTTCTC TGCATACGTG
TTTCTCGGGC CTCTGTAAAC CGTCGCTGAA AATTTAGAAT AGGATCATAT GATTCTTTAA CTTTTTTTTT GGCAAGATCA
TTTTAGACGG TGGCATCCTA AAAGTGGACA AGGTTTGTAC TTTCTGTGTG TATTTTTAGG TAAGACAGTA TTATGCTACA
CATTATTAGC CTATCACCGC AGCGTGTTAA GATCCGCATG AAAAGAATCT GGAGTTTTTT TTTTCTTTTG TTAGACAACA
GAGTAATACG CCAACTTGGC AGCATTGATA ATGAGCAATC TGGTATGAAT TGCTTGTGGG TCTCAGAAAA AAAATAAAAT
AAAAATGAAT TGGTGGTTCC AGTTATGAGA GTGTGAATTG TTCAATTTGA GGAGCAAAAC AAACCAGTAG TGCTGCAAAT
TTCAAGGATG AATTTCAGTG TGCAAACTTA TCATACCATT TTAGGTTGGA TTTGAATAGG AATACCAGCA GCACCAGTTG
TTGAACCCAA ATTTGGACAT ACATGGAAAA GACCATACAT GATACATAGT AGTACTGGTT GGATCGGGTT AATCAGACAG
AAGCACAACA TCTTTACTCG TGGTTGAAAT TGGGAATATC TTCAAAAAAA AAATCGAATA AGATGAAATT ATTATTTTCA
GTCCCCATCA CATTACACCA CTTCCACCTG TCGGAATGAG ACATTCATCC TGTGTCAAGT TGATCCATTG GCATGATGGG
AAATCGGGAT CAACACAGGC TAGAAATTGA GGCGCCATAT ATTGTTGGTT TAAATTTCAG TAGTTCTCTG TGTTAGATCT
GTAAATCTTA TATCGAGTTG AATCAACTGC TTAAAAATTG GAACACTATG GATACATGTT ATGAAGGTTC TAAAAACTTC
AAGTGCACAA AAAATTCACA GAATACTTGA GGTACAGAGT ACTGCTTATG TGCGCTGAAT ACTATTTTTC CCTCTATGCA
TAAAAGGTGA ATCTGACTAT TATGCATTCA TTCATTGCCA AGATGTAAGA TATGCATGTT AAAAATGTTA CCCAGTAATC
AGTAATTATC ATTGTTTTCT TGAAAATGCG AGGTACAACG TATGCCCAAA CGAATTGAAC CCAGCAACAA ACTAAAAAAA
AAAATCCCCT AACTGCTACT TTCTGGCGAA TAGAATTGTC GTTGAGAGAG AGTTTTCATC AGTTCCTCAG GTGGCAAACA
ACTGGTATTG TCGGTCAGAT GCGAGTTTTC GGTACAGAAA TACATCACCA TCGCATCTCA CCATCTTCTT TTGCCGGTGA
AGGTTCATGA GGTTATCATC ATCACAATAA TAATGTACTA CTAGTAGTAG AAAAACAATC ATACTGTGAC TAGTGACAAT
GTTGTACGAC CTAACACAAG AAAGAGTGAA GGAGGAGGAG GATGTATCAG CTAATGGAAC AGAGCCGTCG GTGGTGGTTA
CAGCGGATGA GACACTCAGA CAGGCTGTTG CCAGTCTCTG GTGGTTGGGT TACATGATAG ATCGATGGAT GGATTATATT
AGTGATGATG TTCTGATTAC TTGCATATGT ACTTAGCATG ATTGCCTTTG GACGTATTTG GGAGATGGAT TTTAGTGCAC
GTAATCATCA GAAACAGAAT ATAAACACAT TTTCGGATTC AACTTACATA TTATTAGAAA CACAAATTAG TACTACAGGA
ATATGATTAG TCCGGAGATC TGATAGGACA GATAATGCGG TGCTAGTTTC TTGAATTGTT TGCACTTTCA TGACTCTTAA
CAGGGGCATC TGAACTTTAG CTCGGTTAAA TGTCTAAACC TCAATGTACA GTAGAGTTCA GATCATTTTC ATTTTCAGTT
AAGATGTCTC ATATACTTAT CCTAATCTGA GTAATGTCCT ATAACTACTG ATGGATAGTT GGTTTGTTTT GATACGGAGG
GAGTATGTAG TAACGTGAGT GACATGCAAT TTTGTGAGTG CAGGATTCCA GGTGTGCCAC TCGCTGGGAG GAGGCACGGG
GTCGGGCATG GGCACGCTGC TCATCTCCAA GATCAGGGAG GAGTACCCGG ACCGCATGAT GCTGACCTTC TCCGTGTTCC
CGTCGCCCAA GGTGTCGGAC ACCGTGGTGG AGCCCTACAA CGCGACGCTG TCCGTGCACC AGCTCGTCGA GAACGCCGAC
GAGTGCATGG TCCTCGACAA CGAGGCCCTC TACGACATCT GCTTCCGCAC CCTCAAGCTC ACCAACCCAT CATGTAAGCG
AAGCGATCAT GCACCTTGAC CTTGTGTGTG TAATTTGCTT GAAATTAACA TGATGGAAAT AATGATCAAT TTGCTGTTGT
TGTAGTTGGT GACCTGAACC ACCTGATATC GGCGACGATG AGCGGGGTGA CGTGCTGCCT GCGGTTCCCG GGGCAGCTGA
ACTCGGACCT GAGGAAGCTG GCGGTGAACC TGATCCCGTT CCCGCGGCTG CACTTCTTCA TGGTGGGGTT CGCGCCGCTG
ACGTCGCGCG GGTCGCAGCA GTACAGGGCG CTGACGGTGC CGGAGCTGAC GCAGCagatg tgggacgcca agaacatgat
gtgcgccgcc gacccgcgcc acggccgcta cctcacggcg tccgccatgt tccggggcag gatgagcacc aaggaggtgg
acgagcagat gatcaacgtg cagaacaaga aCTCGTCCTA CTTCGTGGAG TGGATCCCCA ACAACGTCAA GTCCAGCGTC
TGCGACATCC CCCCCGTCGG CCTCTCCATG GCGTCCACCT TCGTCGGCAA CTCCACCTCC ATCCAGGAGA TGTTCCGCCG
CGTCAGCGAG CAGTTCACCG CCATGTTCCG CCGCAAGGCC TTCCTCCACT GGTACACCAG CGAGGGAATG GACGAGATGG
AGTTCACCGA GGCCGAGAGC AACATGAACG ACCTCGTCGC CGAGTACCAG CAGTACCAGG ACGCCACCGC CGAGGACGAC
TACGACGAGG ACGACGACGC CGCCGCCGCC GACGAGGCCT GATCGATCGA TCGATCGATC CCTCCCGCTT TGCCTCTCTG
GCTCTCTGCT ACGCTACGCT ACATATATTT CGATCGGTAC AAACACACAA TGTGCCGTTG CCGTGTCTGC TGCTACTGCT
GCTGCTTGTG TACTGTGCGC TACTACTTGT TGCATGCCTT CGTTCGTTGT CATCGTTGTT CTCTGTCTAA ATTTGTTTAT
TCATGTACAT GAACCGTGGT TTACTCTTTT CTATCTCTGT ATATGTTAGG AAATGTTATC TACTTCATTT TCATGGGACT

Locus: Os03g0661300

Loading...

Locus: Os03g0661300

Loading...