Os03t0664600-00

Locus

Os03g0664600

Description

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLLA2, OsLTPG27, LLA2, LTPG27

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein-like AGP 2, non-specific lipid transfer protein-like arabinogalactan protein 2, GPI-anchored non-specific lipid transfer protein 27, type G nsLTP 27

Transcript Evidence

AK370248 (DDBJ)

Protein Evidence

Q75GY8 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Expression Databases

TENOR (Os03t0664600-00)

Others

Oryzabase (11329)

Transcript

723 bp

>Os03t0664600-00 Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor domain containing protein.
ATGGCAAGGAGCGGGCACGGGGTCGTGGGTCTCGCTCTCGCCGtcgtcgtggcggcggca
gcgacgctgtgcgcggcgcagacgacgatgacgacggcggcggcgtcggtgcagccgacg
gcactgacgaTGCCGAGCTGCCCGGCGGCGCCGCTCAGCCTGTCCCCGTGCATCGGCTAC
GCGTTCGGCGTCGGGTCGGCGACGCTGTCGTCGTGCTGCTCCGAGCTCCGGGCGTTCTTA
CGGTCCCAGGGTCCGTGCCTCTGCGCCGCGTCCAGGCTCGCCGCCGCCGGCCCGTTCGGC
CTGTTCCTCGGCCAGGCGCAGGCCATCGTCCCCAACGTGTGCAACCTGCCCAGCAACCCC
TGCGATGTTGTTGCCATTTCTCGTGGTGATGCATATGCAGATGTGGCCGCGAAAAGCTCT
GAGCCGCGCTCCGCGACGCCGGCGGCACTGGCACCGGCCGCTGCACCGGACACGCCGGCG
ATGACACCGTCTGCGGCGCCGGCTGAACCGGAGGCGTCAGAAGCACCGCCGGTGCCAGCC
GACGATTCTCCTGCTGCCACCGTGACGGCGCCGGGAGACGCTGGATCGAGCGCTGGTTCA
CAAGTTGCATCAAAGCTGCCAGAATTGCTGCATTCAGCAGGTGTACGGAACTCCAGAAAT
ATGGCTGCTGCCGCTGTGATCACTCTGTTTCTTGTTTATGTTTCAGCCATGTATGTGTAA
TCT

CDS

720 bp

>Os03t0664600-00 Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor domain containing protein.
ATGGCAAGGAGCGGGCACGGGGTCGTGGGTCTCGCTCTCGCCGtcgtcgtggcggcggca
gcgacgctgtgcgcggcgcagacgacgatgacgacggcggcggcgtcggtgcagccgacg
gcactgacgaTGCCGAGCTGCCCGGCGGCGCCGCTCAGCCTGTCCCCGTGCATCGGCTAC
GCGTTCGGCGTCGGGTCGGCGACGCTGTCGTCGTGCTGCTCCGAGCTCCGGGCGTTCTTA
CGGTCCCAGGGTCCGTGCCTCTGCGCCGCGTCCAGGCTCGCCGCCGCCGGCCCGTTCGGC
CTGTTCCTCGGCCAGGCGCAGGCCATCGTCCCCAACGTGTGCAACCTGCCCAGCAACCCC
TGCGATGTTGTTGCCATTTCTCGTGGTGATGCATATGCAGATGTGGCCGCGAAAAGCTCT
GAGCCGCGCTCCGCGACGCCGGCGGCACTGGCACCGGCCGCTGCACCGGACACGCCGGCG
ATGACACCGTCTGCGGCGCCGGCTGAACCGGAGGCGTCAGAAGCACCGCCGGTGCCAGCC
GACGATTCTCCTGCTGCCACCGTGACGGCGCCGGGAGACGCTGGATCGAGCGCTGGTTCA
CAAGTTGCATCAAAGCTGCCAGAATTGCTGCATTCAGCAGGTGTACGGAACTCCAGAAAT
ATGGCTGCTGCCGCTGTGATCACTCTGTTTCTTGTTTATGTTTCAGCCATGTATGTGTAA

Protein

240 aa

>Os03t0664600-00 Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor domain containing protein.
MARSGHGVVGLALAVVVAAAATLCAAQTTMTTAAASVQPTALTMPSCPAAPLSLSPCIGY
AFGVGSATLSSCCSELRAFLRSQGPCLCAASRLAAAGPFGLFLGQAQAIVPNVCNLPSNP
CDVVAISRGDAYADVAAKSSEPRSATPAALAPAAAPDTPAMTPSAAPAEPEASEAPPVPA
DDSPAATVTAPGDAGSSAGSQVASKLPELLHSAGVRNSRNMAAAAVITLFLVYVSAMYV*

CDS

chr03:26115036..26115402 (+ strand) : 367 bp

chr03:26115499..26115851 (+ strand) : 353 bp

3'UTR

chr03:26115852..26115854 (+ strand) : 3 bp

FASTA

>Os03t0664600-00 class=Sequence position=chr03:26115036..26115854 (+ strand)
ATGGCAAGGA GCGGGCACGG GGTCGTGGGT CTCGCTCTCG CCGtcgtcgt ggcggcggca gcgacgctgt gcgcggcgca
gacgacgatg acgacggcgg cggcgtcggt gcagccgacg gcactgacga TGCCGAGCTG CCCGGCGGCG CCGCTCAGCC
TGTCCCCGTG CATCGGCTAC GCGTTCGGCG TCGGGTCGGC GACGCTGTCG TCGTGCTGCT CCGAGCTCCG GGCGTTCTTA
CGGTCCCAGG GTCCGTGCCT CTGCGCCGCG TCCAGGCTCG CCGCCGCCGG CCCGTTCGGC CTGTTCCTCG GCCAGGCGCA
GGCCATCGTC CCCAACGTGT GCAACCTGCC CAGCAACCCC TGCGATGGTA CACGCCCCCT GTCCCTGTGC ACTTCACGTC
TTCACCGGCA TTTACAGTTC ATCTAATCTT GAAAAGAAAA TTGGGTGTAA TAATTGATAT AAGTTGTTGC CATTTCTCGT
GGTGATGCAT ATGCAGATGT GGCCGCGAAA AGCTCTGAGC CGCGCTCCGC GACGCCGGCG GCACTGGCAC CGGCCGCTGC
ACCGGACACG CCGGCGATGA CACCGTCTGC GGCGCCGGCT GAACCGGAGG CGTCAGAAGC ACCGCCGGTG CCAGCCGACG
ATTCTCCTGC TGCCACCGTG ACGGCGCCGG GAGACGCTGG ATCGAGCGCT GGTTCACAAG TTGCATCAAA GCTGCCAGAA
TTGCTGCATT CAGCAGGTGT ACGGAACTCC AGAAATATGG CTGCTGCCGC TGTGATCACT CTGTTTCTTG TTTATGTTTC
AGCCATGTAT GTGTAATCT

Locus: Os03g0664600

Loading...

Locus: Os03g0664600

Loading...