Os03t0667500-01

Locus

Os03g0667500

Description

Fe2+ transporter, Uptake of iron

RAP-DB Gene Symbol Synonym(s)

OsIRT1

RAP-DB Gene Name Synonym(s)

Iron-regulated Transporter 1

CGSNL Gene Symbol

IRT1

CGSNL Gene Name

IRON-REGULATED TRANSPORTER 1

Oryzabase Gene Symbol Synonym(s)

OsIRT1, ZIP10, OsZIP10

Oryzabase Gene Name Synonym(s)

IRON-REGULATED TRANSPORTER1, zinc transporter 10, Zrt-Irt-like protein 10

Transcript Evidence

AK107681

Protein Evidence

Q75HB1

Literature

PMID: 19183299

PMID: 16412081

Note

Manual Curation

November 2, 2020

Gene Ontology (GO)

Biological Process: metal ion transport (GO:0030001)

Biological Process: transmembrane transport (GO:0055085)

Biological Process: zinc ion transmembrane transport (GO:0071577)

Molecular Function: zinc ion transmembrane transporter activity (GO:0005385)

Molecular Function: metal ion transmembrane transporter activity (GO:0046873)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

Zinc/iron permease (IPR003689)

Zinc/iron permease, fungal/plant (IPR004698)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

002-132-A08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0667500-01)

RiceXPro (AK107681)

Others

Oryzabase (9295)

KEGG (Os03t0667500-01)

Transcript

1405 bp

>Os03t0667500-01 Fe2+ transporter, Uptake of iron
AAGCAAGCAGCGCGCCTGAGTACGTAGCAAAATCCAGTGTGGTGTACGAACGAAAATGGC
GACGCCGCGGACACTGGTGCCCATTCTGCCGCCCGTCGCGGCGCTCCTCCTCCTCCTCGT
CGCCGCCTCCTCCATCCCCATCCTCGCCGCCGCGCAGCCGGCGGACGCGTGCGGCGGCGC
ACCGGATCAGGCGGCGGCGGACGGCGCGTGCCACGACGTGCCGAGGGCGCTGCGGCTGAA
GCTGATCGCCATCCCGACCATCCTCGTGTCGAGCGTCGTCGGCGTGTGCCTGCCGCTCCT
CTCCCGCTCCGTGCCGGCGCTCCGCCCCGACGGCGGCCTCTTCGCCGTCGTCAAGGCGTT
CGCGTCGGGCGTCATCCTCGCCACGGGCTACATGCACGTGCTCCCGGACGCCTTCAACAA
CCTCACCTCGCCGTGCCTGCCCAGGAAGCCGTGGTCGGAGTTCCCGTTCGCGGCGTTCGT
CGCCATGCTCGCCGCCGTGTCCACGCTCATGGCCGACTCGCTCATGCTCACCTACTACAA
CCGCAGCAAGCCCCGGCCGTCTAGCGGCGGCGACGTCGCCGCCGTCGCCGACCACGGCGA
GAGCCCCGACCAGGGCCACCGGCACGGACACGGACACGGCCATGGGCATGGCATGGCGGT
GGCCAAGCCCGACGACGTCGAGGCCACTCAGGTGCAGCTGCGCCGGAACCGCGTCGTCGT
TCAGGTCCTCGAGATAGGCATCGTGGTGCACTCGGTGGTGATCGGCCTCGGCATGGGGGC
GTCGCAGAACGTGTGCACCATCCGGCCGCTGGTGGCGGCGATGTGCTTCCACCAGATGTT
CGAGGGGATGGGCCTCGGCGGCTGCATCCTGCAGGCGGAGTACGGCCGCCGGATGAGGTC
GGTGCTCGTCTTCTTCTTCTCCACCACGACGCCGTTCGGCATCGCCCTCGGCCTCGCCCT
GACCAGGGTGTACAGGGACAACAGCCCGACGGCGCTCATCGTCGTCGGCCTCCTCAACGC
CGCCTCCGCGGGGCTGCTCCACTACATGGCGCTGGTGGAGCTCCTCGCCGCCGACTTCAT
GGGGCCCAAGCTGCAGGGCAACGTCCGCCTCCAGCTCGCCGCCTTCCTCGCCGTCCTCCT
CGGCGCCGGCGGCATGTCCGTCATGGCCAAGTGGGCGTGAGCTGACGATGCATCACACTC
TGCGGCATCATGCAATTCGCTGCATTGTTAGATTGAGCTTGGTCAGACTCGATCATCAGC
TGCAGACATGTTGTACAGTGACTGTGACTTCTCCATGTTGTACTGTAATTCAGGTTTTCA
GTGTTGTAGCGTGGTTGTTCAGGTTTTGTTCTTCGTGACTGATGATGTACTTCAATACGA
GCATCTACATATTTTCATGATTATT

CDS

1125 bp

>Os03t0667500-01 Fe2+ transporter, Uptake of iron
ATGGCGACGCCGCGGACACTGGTGCCCATTCTGCCGCCCGTCGCGGCGCTCCTCCTCCTC
CTCGTCGCCGCCTCCTCCATCCCCATCCTCGCCGCCGCGCAGCCGGCGGACGCGTGCGGC
GGCGCACCGGATCAGGCGGCGGCGGACGGCGCGTGCCACGACGTGCCGAGGGCGCTGCGG
CTGAAGCTGATCGCCATCCCGACCATCCTCGTGTCGAGCGTCGTCGGCGTGTGCCTGCCG
CTCCTCTCCCGCTCCGTGCCGGCGCTCCGCCCCGACGGCGGCCTCTTCGCCGTCGTCAAG
GCGTTCGCGTCGGGCGTCATCCTCGCCACGGGCTACATGCACGTGCTCCCGGACGCCTTC
AACAACCTCACCTCGCCGTGCCTGCCCAGGAAGCCGTGGTCGGAGTTCCCGTTCGCGGCG
TTCGTCGCCATGCTCGCCGCCGTGTCCACGCTCATGGCCGACTCGCTCATGCTCACCTAC
TACAACCGCAGCAAGCCCCGGCCGTCTAGCGGCGGCGACGTCGCCGCCGTCGCCGACCAC
GGCGAGAGCCCCGACCAGGGCCACCGGCACGGACACGGACACGGCCATGGGCATGGCATG
GCGGTGGCCAAGCCCGACGACGTCGAGGCCACTCAGGTGCAGCTGCGCCGGAACCGCGTC
GTCGTTCAGGTCCTCGAGATAGGCATCGTGGTGCACTCGGTGGTGATCGGCCTCGGCATG
GGGGCGTCGCAGAACGTGTGCACCATCCGGCCGCTGGTGGCGGCGATGTGCTTCCACCAG
ATGTTCGAGGGGATGGGCCTCGGCGGCTGCATCCTGCAGGCGGAGTACGGCCGCCGGATG
AGGTCGGTGCTCGTCTTCTTCTTCTCCACCACGACGCCGTTCGGCATCGCCCTCGGCCTC
GCCCTGACCAGGGTGTACAGGGACAACAGCCCGACGGCGCTCATCGTCGTCGGCCTCCTC
AACGCCGCCTCCGCGGGGCTGCTCCACTACATGGCGCTGGTGGAGCTCCTCGCCGCCGAC
TTCATGGGGCCCAAGCTGCAGGGCAACGTCCGCCTCCAGCTCGCCGCCTTCCTCGCCGTC
CTCCTCGGCGCCGGCGGCATGTCCGTCATGGCCAAGTGGGCGTGA

Protein

374 aa

>Os03t0667500-01 Fe2+ transporter, Uptake of iron
MATPRTLVPILPPVAALLLLLVAASSIPILAAAQPADACGGAPDQAAADGACHDVPRALR
LKLIAIPTILVSSVVGVCLPLLSRSVPALRPDGGLFAVVKAFASGVILATGYMHVLPDAF
NNLTSPCLPRKPWSEFPFAAFVAMLAAVSTLMADSLMLTYYNRSKPRPSSGGDVAAVADH
GESPDQGHRHGHGHGHGHGMAVAKPDDVEATQVQLRRNRVVVQVLEIGIVVHSVVIGLGM
GASQNVCTIRPLVAAMCFHQMFEGMGLGGCILQAEYGRRMRSVLVFFFSTTTPFGIALGL
ALTRVYRDNSPTALIVVGLLNAASAGLLHYMALVELLAADFMGPKLQGNVRLQLAAFLAV
LLGAGGMSVMAKWA*

5'UTR

chr03:26291964..26292018 (- strand) : 55 bp

CDS

chr03:26291295..26291963 (- strand) : 669 bp

chr03:26286479..26286934 (- strand) : 456 bp

3'UTR

chr03:26286254..26286478 (- strand) : 225 bp

FASTA

>Os03t0667500-01 class=Sequence position=chr03:26286254..26292018 (- strand)
AAGCAAGCAG CGCGCCTGAG TACGTAGCAA AATCCAGTGT GGTGTACGAA CGAAAATGGC GACGCCGCGG ACACTGGTGC
CCATTCTGCC GCCCGTCGCG GCGCTCCTCC TCCTCCTCGT CGCCGCCTCC TCCATCCCCA TCCTCGCCGC CGCGCAGCCG
GCGGACGCGT GCGGCGGCGC ACCGGATCAG GCGGCGGCGG ACGGCGCGTG CCACGACGTG CCGAGGGCGC TGCGGCTGAA
GCTGATCGCC ATCCCGACCA TCCTCGTGTC GAGCGTCGTC GGCGTGTGCC TGCCGCTCCT CTCCCGCTCC GTGCCGGCGC
TCCGCCCCGA CGGCGGCCTC TTCGCCGTCG TCAAGGCGTT CGCGTCGGGC GTCATCCTCG CCACGGGCTA CATGCACGTG
CTCCCGGACG CCTTCAACAA CCTCACCTCG CCGTGCCTGC CCAGGAAGCC GTGGTCGGAG TTCCCGTTCG CGGCGTTCGT
CGCCATGCTC GCCGCCGTGT CCACGCTCAT GGCCGACTCG CTCATGCTCA CCTACTACAA CCGCAGCAAG CCCCGGCCGT
CTAGCGGCGG CGACGTCGCC GCCGTCGCCG ACCACGGCGA GAGCCCCGAC CAGGGCCACC GGCACGGACA CGGACACGGC
CATGGGCATG GCATGGCGGT GGCCAAGCCC GACGACGTCG AGGCCACTCA GGTGCAGCTG CGCCGGAACC GCGTCGTCGT
TCAGGTAACG TGTCTCATGC GTTGCAGCTC ACTAGCAAAG CTGTAACCTC ACATCACACA CCCAACTGCG TAATTAATTA
AGGCTGCGTT CTAACCTCAA GGTTCCCAAC CTTTCTCTCT CGttttccgc gcgcacgctt ttcaaactgc taaacggtac
gttttttttt aaaaagtttc tttacaaaag ttgcttaaaa aaattaaatt aatccatttt tttaaaaaat agctaatact
taattaatcg cacgctaata gactgctccg tttttcgtgc ggaagggttg ggtcccaacc cattctatca cacgcagcCT
TAAGAACGCA GTTGAATATG GCAATTCCAA CTTTTTAACC ACTAGTTATT CTTAAATAAT TATTGAACTA CCATAAACGA
AATCATGTTT AAATTTACGG TGCAATATGC TGTGATAGCA TGGTCCATAA TCTTTTTAGT ATTTGCAAAA AAGAAATTAA
AAAAACAGAC GACAAAATGA ATAGTGCCCA CTTATTAAAA AACAGGAGTA ATCGAGTGAT AATTAATTGA GTTTGTTTGA
TCTCtactac ttccagtcta taattcttac attttggaca ttggcacatt ctttaaaata tatctttgat tacatttttt
ctattataat atatgtaata aataaacata tttttatctt ttttcttata ataccttgta agacaaatct atacatgttg
ttttaatgtc tttaaactaa atattttaaa gttaatgata atcaaagtga taaaagttta atcttaacgt acactaaaaa
tcaccctcaa tgtgtaatat CCTCTTAGGT CATAAGGTGG GTCCAGTCAT TAGATAAAAT TGTTGCTACA ATGTATATGG
AAGAGGAGGC ATTAGCTAGG TCCCACTCAA TCAAAATCCA TGTTGGGGGG AGAGGGAAGA GGAGAGAGAA ATTAtactcc
ctccgtctct aaatatttga cgtcgttgac ttttttaaac atgtttgacc gtttgtctta ttccaaaaat ttaagtaatt
attaattctt ttccaaccat ttgattcatt cttaaatata ctactactac tacttctcaa gtttttgaat aatattcacg
aaagtttttt aataagacga acggttaaac atgtttaaaa aagtcaacgg cgttaaatac tccctccgta ctcgtaaagg
aagtcgttta ggacagcgac acggtctcca aaacacaaat ttgacttctt atttctataa aaatatttat taaaaagtga
tatatgtata cttttataaa agtatttttc aagaccaatc tattcatata atttttacat tttcaaacgg gagaatagct
aatatagtcc ctcaagtttc atcgaaggct caatttagtc cttcacgttt tattttgtcc acatagtatt tgttttggct
tgaaatcatc cttgggccca cttaatatgc catatggcta tttctagtca atatttctat tagaaaatgt cccttttgcc
cttaatttgt atacaactat aactagaaaa gagaaaacca agatgaataa aataaattgc agatgtactt tcggcctatt
attttaacat gtgcacatga aacttaagca attgctattg tatacacttt gctagtatat aatttatttt tattttatac
aatttactat gcattatcta taaaaaaaat caagcatgca attttttctc ttatatatgt gaatgatggg ggggtataag
tgtcatttat gaagagagtt gttagttcaa ggataagttt gaactaaaat gaaaacttga aggactaata tggatagatt
gaaacatcaa ggactaaact gagcctcaga tgaaacttgg aggaccACTT taactattta cccttttcaa actcaataac
ttaaaagtta tttatgattt atattcccaa ggtttgactt aaacattatc ataaacgact ttctttacga gtacggagga
agTATCTAGG GACGGAGGGA GTATATTGTT TTTTTTTTAT ATGGGTAGCT CAACATCTCG ACATAAAGAC CACTTGTCTT
GTAGTATATC GTACCTCCTC AGTCAAGTTA GGTAAATCAA GAATTCCAAA GCAAGAGGGA TCTATAGTCG TTAGCCTAAT
CTCAAGGACG CTTCCGTACG GTTCGTAAAG AAAATCTTCG AGATAGTAGG TTAGTAGTCA TGTTCAGTGA ACTCATAGAG
TCGAGTTAAT TGACAAACTA GAAGGTGCCC GTAGCTTTAA ATTATGTGGA ACCTGCAGGA GATAACCACT CCATATTGAC
TCGATGTTTT TTATTCATGA AAATGACACG AGCGGACTAG CTTGTCATGA AAAGTTTCAA CAACAGTCAC TTTTGTAGTT
TCACTGTACT GTAACATGTT ACGGCTGGCC ATCAAGATGA ATTAGTCATC GGAACTTCTT AATTAGTTCG AGAAAATATT
GTAATGTTGA AAGGGAACAA ATTACGTTAG GTTTTGCTCT TAGGCTGAGT TTGAAAAGAG AGGTAGggag attaagcttt
ttcttgaata aaagatgaaa gtcgttagca tacaattaat taattaagta ttagctattg tgaacttgga aaatattttt
atttttattt gattttaaaa taagtttcta tataaaagtt tttttagaaa aatatagtac aatttaataa tttaggaaac
atgctatcgt taaagatgga GTAGCTCACT TCAACTGTTC AGTTGTTCAG AACTCAGGCT TAGATATTAc tccctccatc
ccaaattgat cattatagta tatgtttata caccaagact aaggataatt tgaatcgcat taatcaagac accatgcaca
cattatctca caatgcatgc atcgattaaa acaccatgcc aattataccc ttagcataca cacattctcc cttgctacat
taattgtatt ccgataaaat ccgtatccgt acggttatat gatgatcaat ttgagaaatt ttagattttg ttgtatgatg
atcaatttgg aacggatgga gTACTACTTA TCTATGATAC GCCATTGTAA TTCATGCCCA TTTAAAAAAT AAATTTAATA
AATAGGTTAA ACAAGTGGTA TAAATCATGT CTCAGAATTT ATTTTAAGAA AGCATATTTT AAAGTGTAGA Acaaataatc
atctagctgg ctttcgggct ttggtgagtc gtccgagatc ctttcgatga gatatctata tgatccgttc AGGAAAATGA
ATATCTCCAG AAAATATTTT TAGTTCCGTA TGGCTTTTTT TTCTCTTCAC TCGAACCAAT CCACCTAGAT TTTAATAATA
CGATGAATAA TCTGAAAAGA ATATGACCTC AATCACAAAA TATTAAATTG AGGTCCTGTA ATTTTCCATG TATTTCAGTA
GAAAGTATTC AAACTAACTG GGAGAtgttt ttaatacaaa tcatctttca tatcctacac aaaatatttc tatgctaagc
aatttctctc tcatataaca cataaaaata acttttaaaa tatataaata acaaaacaaa acttgaagct tatataaaaa
cgttcatgtt gtgtaagaac aaaacataca aaaatccata ttaaactttt aatgaaataa atcaattatt aaccttgtaa
ttttgggtat ttttaaaaca agacctaaac taataatata atgtagagca atcgatgaac tcgtcggtat attataaaaa
gaagcaatat caatgataaa tcgttaaact aggacatata tagtagatta tctcttggaa taaaagattg agaatcatac
gaaatttgtt tggaacaata tattcaatga gattttggag aaaagttaat atgaggttga atctctccga agattttctt
ggactcactc actcactctc attcaattct tgtatttttc tgtagcctat ccaaattatt attactgtat ttttttagtg
tgtgttttgc ataagtatcc taccaaaatc ttgtacgttt ccttttatat gctttaaaac tcctatattt caaaggaaga
catattgttg gcaaatagCA AGCGGACATA AACCAGATAT CTTCTTTTCT CCTTTAAATT ATATGTAGTT TCACAAGCAA
AATAAGTGAT GTTTTATACT TAATTTACAG CCAGCTTCTT GTCGAGTACT AGTTGTAAAG TACTCTCGAT TAAGATAACT
TTGAGGCTAA TTAGTCATTA GATTTTTTTG AAACAATATG GTCGGTCAAA CTACAACTAT GCAACTTAAA AGCGAAAAAC
CAAAAAATAT ACTGACCAGA TTTGCACGGC TTCATATGCT GCAGGTCCTC GAGATAGGCA TCGTGGTGCA CTCGGTGGTG
ATCGGCCTCG GCATGGGGGC GTCGCAGAAC GTGTGCACCA TCCGGCCGCT GGTGGCGGCG ATGTGCTTCC ACCAGATGTT
CGAGGGGATG GGCCTCGGCG GCTGCATCCT GCAGGCGGAG TACGGCCGCC GGATGAGGTC GGTGCTCGTC TTCTTCTTCT
CCACCACGAC GCCGTTCGGC ATCGCCCTCG GCCTCGCCCT GACCAGGGTG TACAGGGACA ACAGCCCGAC GGCGCTCATC
GTCGTCGGCC TCCTCAACGC CGCCTCCGCG GGGCTGCTCC ACTACATGGC GCTGGTGGAG CTCCTCGCCG CCGACTTCAT
GGGGCCCAAG CTGCAGGGCA ACGTCCGCCT CCAGCTCGCC GCCTTCCTCG CCGTCCTCCT CGGCGCCGGC GGCATGTCCG
TCATGGCCAA GTGGGCGTGA GCTGACGATG CATCACACTC TGCGGCATCA TGCAATTCGC TGCATTGTTA GATTGAGCTT
GGTCAGACTC GATCATCAGC TGCAGACATG TTGTACAGTG ACTGTGACTT CTCCATGTTG TACTGTAATT CAGGTTTTCA
GTGTTGTAGC GTGGTTGTTC AGGTTTTGTT CTTCGTGACT GATGATGTAC TTCAATACGA GCATCTACAT ATTTTCATGA
TTATT

Locus: Os03g0667500

Loading...

Locus: Os03g0667500

Loading...