Os03t0675600-01

Locus

Os03g0675600

Description

Similar to Phytosulfokines 3 precursor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSK5

CGSNL Gene Name

PHYTOSULFOKINE 5

Oryzabase Gene Symbol Synonym(s)

OsPSK5

Oryzabase Gene Name Synonym(s)

phytosulfokine 5

Transcript Evidence

AK062614 (DDBJ, Best hit)

Protein Evidence

Q9FRF9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cell proliferation (GO:0008283)

Cellular Component: extracellular region (GO:0005576)

Molecular Function: growth factor activity (GO:0008083)

Functional domain (InterPro)

Phytosulfokine (IPR009438)

Full-length cDNA

001-105-B01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0675600-01)

RiceXPro (AK062614)

Others

Oryzabase (14421)

KEGG (Os03t0675600-01)

Transcript

666 bp

>Os03t0675600-01 Similar to Phytosulfokines 3 precursor.
ATGCAGGTTCCATGACCTATTCGATACTAGTCCTACACAAACATAACACGCCATGTCACC
GAAGGTCATAGCCATTTGCCTTGTAGCACTTCTCCTTCCCATCAGCATAAGCCATGGTGG
TAGAATTGGGCCAATTGAACCCAGCAAAGCTTCCAGTAAGGTTGTGGAGAGGGGAAACTA
CGATGGTAGAGTGGAAGGTTGCGAAGAAGATGATTGCCTAGTGGAGCGTTTGCTCGTGGC
TCATCTGGACTACATCTACACGCAGGGCAAACACAATTAGAAGCAGAGGAGTAGATGCAC
GTTTGCAATGAGCAATCCATGCAAGAATAAACCGCCGAGCAGAAAAAAGAAAGCGAGCAA
GCTTGACGTTAGATGATAATGTGTGTACAACCTATATATCATGGGAAAATAGAGCCGCTG
GATATCAGGAAGACAGGAAGGAGCCTGATATCAATAATTATGAAGAAATATGAGCACACT
CCGGAAATGGAATCAAGTGCGAGAAGGCGTCCAGCTAAGCTAATAACTGAGCTAGGCGCA
GTTCTCTGAGCTACCCATTGTGTTTTTTTCTAGAGTGGAGAAAGTATATATAAAGTTTGT
ATGAAGTTTAAGTGTTTGTATGTATGTATGAAGTTTGTAAAGGTAATTATGAACTTATGT
TGTTCG

CDS

228 bp

>Os03t0675600-01 Similar to Phytosulfokines 3 precursor.
ATGTCACCGAAGGTCATAGCCATTTGCCTTGTAGCACTTCTCCTTCCCATCAGCATAAGC
CATGGTGGTAGAATTGGGCCAATTGAACCCAGCAAAGCTTCCAGTAAGGTTGTGGAGAGG
GGAAACTACGATGGTAGAGTGGAAGGTTGCGAAGAAGATGATTGCCTAGTGGAGCGTTTG
CTCGTGGCTCATCTGGACTACATCTACACGCAGGGCAAACACAATTAG

Protein

76 aa

>Os03t0675600-01 Similar to Phytosulfokines 3 precursor.
MSPKVIAICLVALLLPISISHGGRIGPIEPSKASSKVVERGNYDGRVEGCEEDDCLVERL
LVAHLDYIYTQGKHN*

5'UTR

chr03:26730963..26731014 (+ strand) : 52 bp

CDS

chr03:26731015..26731122 (+ strand) : 108 bp

chr03:26731304..26731423 (+ strand) : 120 bp

3'UTR

chr03:26731424..26731809 (+ strand) : 386 bp

FASTA

>Os03t0675600-01 class=Sequence position=chr03:26730963..26731809 (+ strand)
ATGCAGGTTC CATGACCTAT TCGATACTAG TCCTACACAA ACATAACACG CCATGTCACC GAAGGTCATA GCCATTTGCC
TTGTAGCACT TCTCCTTCCC ATCAGCATAA GCCATGGTGG TAGAATTGGG CCAATTGAAC CCAGCAAAGC TTCCAGTAAG
GTGAAGGAAA AAAACTGTTT TTCTTTCTTT TAAATTTAGT TTCAGTTGTA CATTTGATAT CATGTTGCAT CACGACATGT
TTTCCTTTGA TAAATTTGCA TGTACGAAGT AGTGTAATTT GATTAATTGA ACGTATCTTT AACCGATTTT TTACCATCAT
GTTGTGGGTA TCGTGGCACA GGTTGTGGAG AGGGGAAACT ACGATGGTAG AGTGGAAGGT TGCGAAGAAG ATGATTGCCT
AGTGGAGCGT TTGCTCGTGG CTCATCTGGA CTACATCTAC ACGCAGGGCA AACACAATTA GAAGCAGAGG AGTAGATGCA
CGTTTGCAAT GAGCAATCCA TGCAAGAATA AACCGCCGAG CAGAAAAAAG AAAGCGAGCA AGCTTGACGT TAGATGATAA
TGTGTGTACA ACCTATATAT CATGGGAAAA TAGAGCCGCT GGATATCAGG AAGACAGGAA GGAGCCTGAT ATCAATAATT
ATGAAGAAAT ATGAGCACAC TCCGGAAATG GAATCAAGTG CGAGAAGGCG TCCAGCTAAG CTAATAACTG AGCTAGGCGC
AGTTCTCTGA GCTACCCATT GTGTTTTTTT CTAGAGTGGA GAAAGTATAT ATAAAGTTTG TATGAAGTTT AAGTGTTTGT
ATGTATGTAT GAAGTTTGTA AAGGTAATTA TGAACTTATG TTGTTCG

Locus: Os03g0675600

Loading...

Locus: Os03g0675600

Loading...