Os03t0681400-01

Locus

Os03g0681400

Description

Similar to Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19) (Ubiquitin- conjugating enzyme 15) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (PM42).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UBC25

CGSNL Gene Name

UBIQUITIN-CONJUGATING ENZYME 25

Oryzabase Gene Symbol Synonym(s)

OsUBC25

Oryzabase Gene Name Synonym(s)

Ubiquitin-conjugating enzyme 25

Transcript Evidence

AK103809 (DDBJ, Best hit)

Protein Evidence

B9HFA8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: acid-amino acid ligase activity (GO:0016881)

Functional domain (InterPro)

Ubiquitin-conjugating enzyme, E2 (IPR000608)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Full-length cDNA

J033147A12 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0681400-01)

RiceXPro (AK103809)

Others

Oryzabase (19565)

KEGG (Os03t0681400-01 (EC:6.3.2.19))

Transcript

793 bp

>Os03t0681400-01 Similar to Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19) (Ubiquitin- conjugating enzyme 15) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (PM42).
GCACACCTTTCCCCCCCTCTCTCCCTCCCTCCTCCGCCATCCCTAGCAGCCGCCCCGCAC
CCGCGCCCGCACCATGACGAGCTCCTCCTCCCCTTCCCGCAAGGTGCTGAGCAAGATCGC
GTGCAACCGGCTGCAGAAGGAGCTCGCGGAGTGGCAGGTCAACCCTCCCTCCGGCTTCAA
GCACAAGGTCACCGACAATCTCCAGAGGTGGGTCATCGAGGTCGCGGGGGCTGCGGGCAC
GCTCTATGCCGGAGAGACATACCAATTGCAGGTGGACTTCCCTGAGCATTACCCCATGGA
GGCTCCCCAGGTCATATTTCTTCATCCAGCGCCAATGCATCCGCACATTTACAGCAATGG
GCATATCTGTTTAGATATATTGTATGACTCGTGGTCACCGGCGATGACCGTTAGTTCTGT
TTGTATCAGTATCTTGTCCATGTTGTCAAGCTCACCAGCAAAGCAACGTCCTGCCGACAA
TGATCGCTATGTCAGGAACTGCCGCAATGGGAGGTCGCCGAAGGAGACCAGGTGGTGGTT
TCATGATGACAAAGTGTGATTGGTTCCAACTTCCGGTTGGCTTCTCCTCAGCAACCCTTT
TACCCGCCACCCTACCTTTACATGGCGTCCTCCATGGGAGATGATTTAGGCATATTTTTA
AGCGATCTATTTGACCGCAAATTAACATGCCTTTGTGGTTTGTAAATGAATGTGAACCTG
TATCGAATCCTAGACTTATTAATTACTATACCTTGGATATATAGAATAATTACATGTGTA
TCTTGCTTATTGC

CDS

486 bp

>Os03t0681400-01 Similar to Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19) (Ubiquitin- conjugating enzyme 15) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (PM42).
ATGACGAGCTCCTCCTCCCCTTCCCGCAAGGTGCTGAGCAAGATCGCGTGCAACCGGCTG
CAGAAGGAGCTCGCGGAGTGGCAGGTCAACCCTCCCTCCGGCTTCAAGCACAAGGTCACC
GACAATCTCCAGAGGTGGGTCATCGAGGTCGCGGGGGCTGCGGGCACGCTCTATGCCGGA
GAGACATACCAATTGCAGGTGGACTTCCCTGAGCATTACCCCATGGAGGCTCCCCAGGTC
ATATTTCTTCATCCAGCGCCAATGCATCCGCACATTTACAGCAATGGGCATATCTGTTTA
GATATATTGTATGACTCGTGGTCACCGGCGATGACCGTTAGTTCTGTTTGTATCAGTATC
TTGTCCATGTTGTCAAGCTCACCAGCAAAGCAACGTCCTGCCGACAATGATCGCTATGTC
AGGAACTGCCGCAATGGGAGGTCGCCGAAGGAGACCAGGTGGTGGTTTCATGATGACAAA
GTGTGA

Protein

162 aa

>Os03t0681400-01 Similar to Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19) (Ubiquitin- conjugating enzyme 15) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (PM42).
MTSSSSPSRKVLSKIACNRLQKELAEWQVNPPSGFKHKVTDNLQRWVIEVAGAAGTLYAG
ETYQLQVDFPEHYPMEAPQVIFLHPAPMHPHIYSNGHICLDILYDSWSPAMTVSSVCISI
LSMLSSSPAKQRPADNDRYVRNCRNGRSPKETRWWFHDDKV*

5'UTR

chr03:27116364..27116436 (- strand) : 73 bp

CDS

chr03:27116334..27116363 (- strand) : 30 bp

chr03:27116080..27116183 (- strand) : 104 bp

chr03:27115672..27115774 (- strand) : 103 bp

chr03:27115496..27115559 (- strand) : 64 bp

chr03:27111910..27111998 (- strand) : 89 bp

chr03:27111729..27111824 (- strand) : 96 bp

3'UTR

chr03:27111495..27111728 (- strand) : 234 bp

FASTA

>Os03t0681400-01 class=Sequence position=chr03:27111495..27116436 (- strand)
GCACACCTTT CCCCCCCTCT CTCCCTCCCT CCTCCGCCAT CCCTAGCAGC CGCCCCGCAC CCGCGCCCGC ACCATGACGA
GCTCCTCCTC CCCTTCCCGC AAGGTACCAA ACCCTAACCC TAACCCCCTC CTCTCTACCC TCATCCCCTC CGGATCCCAT
CTCCCCTCCG CCCCGATTCG CCGTAATTTG TTTTGGGGGT TTTTTTCTCT CTCTCTCTGA GCTGTTTGTG TGTGTGTATG
TGTGTTCGTG CAGGTGCTGA GCAAGATCGC GTGCAACCGG CTGCAGAAGG AGCTCGCGGA GTGGCAGGTC AACCCTCCCT
CCGGCTTCAA GCACAAGGTC ACCGACAATC TCCAGAGGTG ACCCCCCCCC TCCCCCGCGA CCACTCCAAA CCCACGCGGT
TTTTGTCCTT GCCGCTTTCG CGTTTCGTCT CTTTCCCTTT CGATTCAGAT GAAATCGCAA ACCCTTTTCG GCGTCCTGAT
TGACCCAGGA TCTCCTTTTT TTCTATGAGG GTTTTGGCCG CGTAGTCGTG AAATATTCAG TCGTTCATGT TCTTGTATGA
TTTATTTATT TTCAACTTTG ATACTTTCTT GTGATTTTTT ATCCATGTGA AAAGCATGAA AAATAATATA TCATGATATG
GATTATTCCG AAATAAAAAA AGGTGGGTCA TCGAGGTCGC GGGGGCTGCG GGCACGCTCT ATGCCGGAGA GACATACCAA
TTGCAGGTGG ACTTCCCTGA GCATTACCCC ATGGAGGCTC CCCAGGTGGG ATTTCTTGCC TTCTCTTTAT ACTATTTATT
TATACTGTGT TTAGTTTGGG TATACTGCAT GCACTGGAAT CCAACGCTTT GGGTTTGATC GACTTGTTTT TCTGTAGGTC
ATATTTCTTC ATCCAGCGCC AATGCATCCG CACATTTACA GCAATGGGCA TATCTGTTTA GGTAAAATGA TTGTATGCTC
CTATTGATGC ATAAATAATT GTTGTTTTCG TTCTTGATGC TTTTGCCCAC TCCATTAATT CTCTTGGGTG TACAGCATTT
TTACTGGACC TGTTTTACAG TTTTAGCATG TCCACGAAAT ATGCCTTTCT GTCTTGCTAA TGAAAGCTGC CATCTTCAAT
GGCAAGCATA ATACTTAGGA GTTTAAAGTA GTAAATAACT AGGGTAGTAA CTGTATGATA AGTTTTAAAC ACATTTAGCT
ATCCCAGCTG TACCTTTTAA CTTTATATAT GCTGGGAAGT GTACAAACTT AGAAAGTAAC ACTTGAAGTC CTTAGATATG
GGTGTATGGG CATAGAGGAA GTGACTAGAA TATAGGTGGA TTAACCTTAT CCACTTCTAT TTGTCTAGGG TAATCCTGTG
TTAGATAATG TTGACCAAGA TCAACACTTG TCTCTTCCAC CACCACATGT TGTTTTTAGC ACCTTTGCAT ATCCTCTTGT
CGTTCATGAT CAAGAACTCC CAACTTTTTG ACACATCTGG GCAATTCTGC TATTATGTTC CTGATTGACA TTTAACAATT
TGACTATTGG CTGTGCTGTG ATGTCTGGTC TGTTCATGGA GGTTCTGGAT GTAGTTAAGC TGAAATTCTA GCCTATGTGG
TTATCTAGTT AAATTTATCC TTAAGAGGCT GCACCCCTTA TTTAGTGGAA GTTCTCTTGT AAGTTACAAC ACACAAGTTA
ATTGATGTGT ACTATGTACT TTATGTAATT CCTTGATGCA TTGAAATGGA TGGTTACAAA CTTTCCGGTG GATTGGTAAA
ATAGTTTATG ATAGAGCGGT GTTGAGATGA ACCATTCAAT AAATTCTCCC AACGTAGCAA ACCTGTACAA TAAGATGTCT
TGTACTCAAC AATTTTTACA AGATGTTATG AAACACATAA TACATGCCTG CCAGATACCT CAAGTTATTA GATGTTATTG
TTGTGCATAT ATTCTAATGG TGGGATATTC CAAAATTTTC TTGTATTAAT GGGACAATAC TGTACATTGT CATCGGATAT
TGTCCTGCCT GCTGTGAAAT GTTCAATCCA GTGTAGATTG CTAAGTGTAC AGAATCTAAC TAGTTTGTCA TCCTTTTCAA
GAAAAATGGT TGCCCATGAT ATAAGCATTC CCACTATCAG CTTACATTAA TATTGGCAAG CACAAGTCCT CTGCAGTATT
ACTTCTCTAG TTAAAGCAAT GCCTTTTTGC AGATGTATAT GCAGCAGATG CACCCTAGAA AATTTTCAAA TCTTGAGCAT
CCTGACCATG GTTCAAGAAG GCGCTAGTTG GGTGACTGGG GGGCGCCTCG GTCAGGCCAG ATAGTCAAAT CCAAGAAATT
AGCAAGCATA TTGCATAAAA CTTGGACTTC ATAACACTAA AATAGCAACA GAACACCACC CACGTTAGTT CAGCCGCCTA
ATGCACCATC TAATACTTAA TCGTGGCGGC TACCTAGTGC ATAGAGCCAA CTTTTAGAAA ACTGATCTTG ACTCCCAAGT
TGCTCATATT TAACGGCTTA CCCATAGTAT AAAAATCCAC CAGACGGCAA GCCGGCACAA CTCGTGGTTC ACAGCAACCC
CCACTGCCAC CCCCCCTCCC CCCCAGCACA CACACACACA CACTGCCTGG TCCCACTGTT GGACTGCTGA ACCATGGCTC
ACTAAAATCG ATACCGATGT ATATTCTCCA TGTAACACAA GTGATTTGCT ACCTGGATGG TTGAAGGGCA GCAGCTGCAG
GTTGCTCACC AGTGTTCTAT CCTCTGCCTC CTTTTTTTTC TCATAACTGG GCCTAACTTG CCATTCACTG ATGAGCCGTG
CGGTTTATGA TCCGTTTCCA TTGGTTCACC AGTTCTTAGA AAAACCATCT GGTTTTCCTG GTTTACTCTC CTGTCCAATA
GCAGAAGCGA TCCTTCACAC AAACCAAACC GGAAGGGATG CTGGTTAAGT ATGATGGTGC ACCTTCCTCT TTTTTAACTG
AATTATTGTC TTTTCAACTT TGCAAACATT CAGTTCCTTT CCTAATGCAG TGATGCCACT TTTTGGAATG ATTGTTTTGC
TACTTTATTT GTCTATCACT CCACCTGTCT AGTTCAGTAC AAAATGAAAT TTGGTGAATT GAGTTGTGCA TTTGCATTCC
CCTTTACTTT CTAACATTAA TATAACCATG TTTTGACTTT TAATGCAATA CATGACCAGA GGAATGCCTC CTTTTATGCA
AAGAGCATGT GTTTTGTAGG TGAAAGGTAT CTATTACACC ATACAAATGA ATCTAGCATG GCTCAATGCA TTTAATTCCC
TTACTATGTG TGCTGGATAA CCTTTTTTCC CGGTTTGATG GTGTGGCTTG TTTGTTTTTT CCTGTCAACT AGCGACATAC
CCATGCTTTG CTATTGGCAG AAGAAACAAA ATATTATTGT ATGTCATAGT AAAACATATT TTATCAAATA TCTTAGCATC
ACTTGTTTGC TTAttttatt atctgatact agaaaaaatg cccgtgcgtt gcaatcggtg aaggctattt taattttatt
attgttatac ggtttagcta aggtgaaatt cactacggga atttgcttgg atatatgtta gaaaatcatg agctgcaatt
aggagtacga ctcatgtctc aagttagtat gcgaattttt tttaaagaga tttcttatat gactcctgta tttccaaaag
cgaataaact taaaaaaacc aactcaaaca cagatctgta tttccaaaag caaacaaact taaaaaccga ctcaaacacg
gatgacgtac gaaagtaccg gcaaaaacat cttcaatttt tataatagtg gagATttact tgattggacc aaatattgga
ctattccata atattagaaa atatcatgga acaatttgta aaaactgcta aagCAATAGC GGGGTGGCAG ATTCATTGCC
ACCACCACTT GAGGCTTTTA AATAAGTTTA TATATTGGTT AATTGCCACG TTAATTTCTA GGTTATTTTT TAGGGCAAAG
CAGGGCTAAA TTTATTACTT GGAGAATATG ATGGATATGC TTCCGAGCTT TTTGCTGGCC TATGTTATCA AGAATTCAAG
AGATGTCTTT CTAAAATAAA GGACCGAAAC CTGCGATTTG GTGACACAAA ATACCTTGCA TGCCTTTTTT TTTTTTTGTA
ATTCTGGACC CTAAAAATGC TAAATTTTGC CCCCTTTTTA TTTTTTTTCT TTGTACACAT TGTTTGGAAA GTCTACTCAC
GATTGCCTTT ATAATTTGAA GTTTTGAACC TAACCAGCGA GAAAATGGAA ATCTAATGGA CTACTTGGGT TGCCTTAGTG
GTTGTATTTT TGCTTGGATG GGTTCTGGAA TTTTTGTCCA CCTACCATCT TTGTTTAACA ATTAACATGT CAATTTGACC
GCAGATATAT TGTTTACTGT TGTTTCACTT GTCTGCAGAT ATATTGTATG ACTCGTGGTC ACCGGCGATG ACCGTTAGTT
CTGTTTGTAT CAGTATCTTG TCCATGTTGT CAAGCTCACC AGCAAAGGTT ATAGAGCTTC ACTGTGTCCT CTCCTGTTTA
AATGGAGATC ATGCATCTGA CCATATTATA TGTTTATTAT ATGTTGGTGC AGCAACGTCC TGCCGACAAT GATCGCTATG
TCAGGAACTG CCGCAATGGG AGGTCGCCGA AGGAGACCAG GTGGTGGTTT CATGATGACA AAGTGTGATT GGTTCCAACT
TCCGGTTGGC TTCTCCTCAG CAACCCTTTT ACCCGCCACC CTACCTTTAC ATGGCGTCCT CCATGGGAGA TGATTTAGGC
ATATTTTTAA GCGATCTATT TGACCGCAAA TTAACATGCC TTTGTGGTTT GTAAATGAAT GTGAACCTGT ATCGAATCCT
AGACTTATTA ATTACTATAC CTTGGATATA TAGAATAATT ACATGTGTAT CTTGCTTATT GC

Locus: Os03g0681400

Loading...

Locus: Os03g0681400

Loading...