Os03t0684000-01

Locus

Os03g0684000

Description

Similar to GATA transcription factor 1 (AtGATA-1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GATA18

CGSNL Gene Name

GATA TRANSCRIPTION FACTOR 18

Oryzabase Gene Symbol Synonym(s)

OsTIFY1A, TIFY1A, OsCCT13, OsGATA18, OsGATA18a, OsGATA18b

Oryzabase Gene Name Synonym(s)

TIFY GENE 1A, TIFY-DOMAIN PROTEIN 1A, CCT domain-containing gene 13, CCT (CO, CO-LIKE and TOC1) domain protein 13, CCT domain protein 13, GATA transcription factor 18, GATA factor 18

Transcript Evidence

AK105025 (DDBJ, Best hit)

Protein Evidence

NP_001149566.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Zinc finger, GATA-type (IPR000679)

Tify (IPR010399)

CCT domain (IPR010402)

Zinc finger, NHR/GATA-type (IPR013088)

Full-length cDNA

001-011-G08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0684000-01)

RiceXPro (AK105025)

Others

Oryzabase (15739)

KEGG (Os03t0684000-01)

Transcript

1476 bp

>Os03t0684000-01 Similar to GATA transcription factor 1 (AtGATA-1).
ACACCCAGTACCAAGTGCACAGCCGCAGCGCCGCATCACCGCCTTCCATTTCCACATCTA
GGGTTTCAGTTGAGTCGAGTTGAGTCCCCCTCCCCCCACGGCCCCACCTCGCCACCGCCG
GCCATGCCCGACGCGGCGGCCGCCGCCGCCGCCGCCCAGGACGCCGACGCCGTGATGCGC
GACGCACCCGCCGACGCAGCAGCAGGCGGCGGCGACAACGACGACGACGACGGGGATGAC
GGCACAGAAGAGGACGAGGAGGAGGATGACGACGAGGAGGGCGATGAAGAGGAGCTGCCG
CCGGCCGAGGATCCGGCGGCCCCGGAGCCGGTCTCGGCGTTGTTGCCGGGGAGCCCGAAC
CAGCTGACGCTGCTGTTCCAGGGCGAGGTCTACGTGTTCGAATCCGTGACGCCTGAGAAG
GTTCAAGCTGTTCTGTTATTGTTAGGAAGAAGTGAAATGCCACCAGGTTTAGCTAACATG
GTTTTACCAAATCAACGTGAGAACAGAGGTTATGATGATTTACTTCAGAGAACAGACATT
CCTGCCAAAAGGGTTGCTTCACTCATTAGGTTCCGTGAAAAGCGGAAGGAAAGAAATTTC
GATAAAAAAATACGTTACGCCGTACGCAAAGAAGTGGCACTCAGGATGCAACGTAGGAAG
GGTCAATTTGCCGGAAGAGCAAATATGGAGGGAGAGTCCCTATCTCCAGGCTGTGAACTT
GCTTCCCAGGGTTCAGGCCAAGATTTTCTATCTCGAGAATCAAAGTGTCAGAATTGTGGC
ACTAGTGAAAAAATGACACCGGCAATGCGCCGTGGTCCAGCTGGTCCAAGGACTCTGTGC
AACGCCTGCGGACTGATGTGGGCTAACAAGGGTACCCTGAGAAATTGCCCCAAGGCAAAA
GTTGAATCTTCTGTGGTTGCAACTGAGCAGAGCAATGCAGCTGTCTCTCCGAGTGGAATC
GACAACAAGGAATTGGTGGTACCAAACCCTGAAAACATTACCGCAAGCCATGGCGAAGTC
ATGGGCGACAGCACTCCGGCAAATGAAGCCGAGATAGGAGCGCCAAAGGCGCAGTCACAA
TAAGTTTATGTTTAACCTGTCATGATTGAAACCAAAAGATTCTGGATTCTTTGCCTACAG
GCTATACAGCTAAACATCACAATAGAAGGTCTTTTTCCTGACCAAAGTATACTGATTCTC
CTCAAGTGTACAATTCTTGCTTGCCAGCACATGTAAATGTAATTGTAATTAACATAAAGA
GCCTGATTGGTGCCTGTTGTGTAAACCCCTCATTCTCATGACATCTAAGATAGCACATCA
AGCAGACTGTCATGTACTTCCGGCTTTGGAGCTGCTTCTGAAGGGGAGTTGTCTGATGGT
GCTTAGTGTCCCTTCCTAACTACTACGCCTGTAAAGTTGTACCAACTGATCCTTGTACAG
TTTGTATTAATGTGTCGTCTCTGTCTTTCGTTTTCC

CDS

960 bp

>Os03t0684000-01 Similar to GATA transcription factor 1 (AtGATA-1).
ATGCCCGACGCGGCGGCCGCCGCCGCCGCCGCCCAGGACGCCGACGCCGTGATGCGCGAC
GCACCCGCCGACGCAGCAGCAGGCGGCGGCGACAACGACGACGACGACGGGGATGACGGC
ACAGAAGAGGACGAGGAGGAGGATGACGACGAGGAGGGCGATGAAGAGGAGCTGCCGCCG
GCCGAGGATCCGGCGGCCCCGGAGCCGGTCTCGGCGTTGTTGCCGGGGAGCCCGAACCAG
CTGACGCTGCTGTTCCAGGGCGAGGTCTACGTGTTCGAATCCGTGACGCCTGAGAAGGTT
CAAGCTGTTCTGTTATTGTTAGGAAGAAGTGAAATGCCACCAGGTTTAGCTAACATGGTT
TTACCAAATCAACGTGAGAACAGAGGTTATGATGATTTACTTCAGAGAACAGACATTCCT
GCCAAAAGGGTTGCTTCACTCATTAGGTTCCGTGAAAAGCGGAAGGAAAGAAATTTCGAT
AAAAAAATACGTTACGCCGTACGCAAAGAAGTGGCACTCAGGATGCAACGTAGGAAGGGT
CAATTTGCCGGAAGAGCAAATATGGAGGGAGAGTCCCTATCTCCAGGCTGTGAACTTGCT
TCCCAGGGTTCAGGCCAAGATTTTCTATCTCGAGAATCAAAGTGTCAGAATTGTGGCACT
AGTGAAAAAATGACACCGGCAATGCGCCGTGGTCCAGCTGGTCCAAGGACTCTGTGCAAC
GCCTGCGGACTGATGTGGGCTAACAAGGGTACCCTGAGAAATTGCCCCAAGGCAAAAGTT
GAATCTTCTGTGGTTGCAACTGAGCAGAGCAATGCAGCTGTCTCTCCGAGTGGAATCGAC
AACAAGGAATTGGTGGTACCAAACCCTGAAAACATTACCGCAAGCCATGGCGAAGTCATG
GGCGACAGCACTCCGGCAAATGAAGCCGAGATAGGAGCGCCAAAGGCGCAGTCACAATAA

Protein

320 aa

>Os03t0684000-01 Similar to GATA transcription factor 1 (AtGATA-1).
MPDAAAAAAAAQDADAVMRDAPADAAAGGGDNDDDDGDDGTEEDEEEDDDEEGDEEELPP
AEDPAAPEPVSALLPGSPNQLTLLFQGEVYVFESVTPEKVQAVLLLLGRSEMPPGLANMV
LPNQRENRGYDDLLQRTDIPAKRVASLIRFREKRKERNFDKKIRYAVRKEVALRMQRRKG
QFAGRANMEGESLSPGCELASQGSGQDFLSRESKCQNCGTSEKMTPAMRRGPAGPRTLCN
ACGLMWANKGTLRNCPKAKVESSVVATEQSNAAVSPSGIDNKELVVPNPENITASHGEVM
GDSTPANEAEIGAPKAQSQ*

5'UTR

chr03:27273994..27274116 (- strand) : 123 bp

CDS

chr03:27273697..27273993 (- strand) : 297 bp

chr03:27272598..27272684 (- strand) : 87 bp

chr03:27272377..27272513 (- strand) : 137 bp

chr03:27271346..27271465 (- strand) : 120 bp

chr03:27271147..27271252 (- strand) : 106 bp

chr03:27270406..27270465 (- strand) : 60 bp

chr03:27270239..27270327 (- strand) : 89 bp

chr03:27270100..27270163 (- strand) : 64 bp

3'UTR

chr03:27269707..27270099 (- strand) : 393 bp

FASTA

>Os03t0684000-01 class=Sequence position=chr03:27269707..27274116 (- strand)
ACACCCAGTA CCAAGTGCAC AGCCGCAGCG CCGCATCACC GCCTTCCATT TCCACATCTA GGGTTTCAGT TGAGTCGAGT
TGAGTCCCCC TCCCCCCACG GCCCCACCTC GCCACCGCCG GCCATGCCCG ACGCGGCGGC CGCCGCCGCC GCCGCCCAGG
ACGCCGACGC CGTGATGCGC GACGCACCCG CCGACGCAGC AGCAGGCGGC GGCGACAACG ACGACGACGA CGGGGATGAC
GGCACAGAAG AGGACGAGGA GGAGGATGAC GACGAGGAGG GCGATGAAGA GGAGCTGCCG CCGGCCGAGG ATCCGGCGGC
CCCGGAGCCG GTCTCGGCGT TGTTGCCGGG GAGCCCGAAC CAGCTGACGC TGCTGTTCCA GGGCGAGGTC TACGTGTTCG
AATCCGTGAC GCCTGAGAAG GTCGGTCTCT TTACTCCGCT CATCACCTCG TGTCGCTTTC CTTCCGCAAT CGTCCTGGAA
ATGTTTAGCT CAAAAAAATT TCGTGGGATA CGATGAGGAA TTTGACGTGT TAGTGTTCGT GCGCCGCAAT CGGATATATG
ATTGGTATAT TGTGGTTTCT TGTTTGTTTC GAGTCATTCT GTGGGTAGGA TTCTTACAGT TCAGGAATTC TGGATTAGTG
CTGCTACTCC CACGAAATGT CCCTCTGTTT TTTTTTTAAC TTGAATCTCC TTTGCTACTG TCACTTCAGC TAGTTTACAA
TGTTGATTGT TGGATACTGT TACACCAAAA AACGCAACAC TAGAAATGTA CTAATTTATT CTATTTGGAT AATATGGTTG
ATTTGGTTTG AAGTATACCG TCATGTTCAT GTAGACTTGA ATATTGGATA TACCTATCTT AGACTGTTAG TAACTTAGCG
CAGAGCGGTC CAGCCTCTGA ATTAGTGTAA GCTCGCAGTT GCAATACAAC AAGTAGCCAC TATTATCCTC TGGCTCATAG
TTTTAGTAAC GGTTAATATG ATTctctctc catcccaaaa tatagcaact tgatactacg attagacacc acctatatta
caaatctgga caagatgtct atccaaattc atagtactag gtggtatcta tcgtattact tgattgctat attatgggac
ggagggagta TGTCAGTTCT TATCACTCAC GTAGATTACT AGTAACACAT GGTGATGACT TGCTATTTCC TACAAGTTAG
TCCTTGGAAC TTTTCAGTTG TGCAGTTTGT GACCCGAGTT TTCTGTTGTT TTTGTTCTTG GCTGGAATCC TGATTCATGT
AAACAATATG ATGGCTTGTA TAACTGCTTG CTATAATCCC AAGTTAAATT TATTCCAGAG TTGAGTTTTC TGAATATTCA
TTTAGGTATA GGTATTTCTT TTGTTCCCTT TTATGGTCCT GTCTTTTCAT AAGATGAAGT TTTTTTTCCC AGGTTCAAGC
TGTTCTGTTA TTGTTAGGAA GAAGTGAAAT GCCACCAGGT TTAGCTAACA TGGTTTTACC AAATCAACGT GAGAACAGAG
TATGTGGAAA TAAATAGTTC CATAGTCGCT TGGCAATCTG TATTGTTTTC TTCGTTTATA GTTCATGTTA GAATTATCTG
CAGGGTTATG ATGATTTACT TCAGAGAACA GACATTCCTG CCAAAAGGGT TGCTTCACTC ATTAGGTTCC GTGAAAAGCG
GAAGGAAAGA AATTTCGATA AAAAAATACG TTACGCCGTA CGCAAAGAAG TGGCACTCAG GTTTGTATCT AGTCTGATTG
AGTATTCACC GATCTTTTGC AAATTCTACC ACAGAAGAAG GCATAGATGA ACCATGTGGA TTTGCTACAG TCTTCTAAAT
TTGTTTAGAT CAATCATCAT TCTTTTTCAT TCTTCTAGTT GATGGAACTG CTTTAGTGTC CATGGGGAGC ACATGAACAT
TTTCATTAGG GGTTCTCAAT TTGATTAGCA ATCAATGTGT CTACTGCTTG ATTGGTTCCA TGATCATACC ATGAACATCT
ACCAATATAA TTTGCAAGAA AAAAATGCAA GCTCAATTTT TTGTTGTCCC TGGATGCTAG TTGCTCAATA TGTTCCAACA
ATTAATTGCA TGGCTCCATT AGAATAAAAA TGTAACAAAT TAACTGACTT AAGACTGGAG GTCTGGAGCT GTACTTCTGT
GTAGCTTTAA CTAAGAGCAA GATGTACCAT ATCCATTGTA TCAATGAGCA ATGGATGGAT GTTATGAGTC TTTTTTGTGG
TAAAAAAAAT CTAATGATTT ATGCTGCTAC CTATTACTTT CTGTGTCCGA TTGTTTTAGC CATCACCATT GTTGTCACCT
CAATCTTTCC AGCTCCATCT CCTTTGTGAA TTTTGTGTTT GTTGAATACT GACAGACAAG AATGATTGGG GCCCTGGCCA
GCAGTGATGG TACAAATAGT TCGCATACAT GCTAGGCACA GCATCAATGG ATAGAAGCTA GGCTGGAGAT AGATTAGGCA
TAGGTAGGAG GTAAAGGATG GGATGATAGA TCCCGTGGAT TACATTGTTT GCAGACCCAG GCGCATAAAA TTCTGCACAT
CAAGCTATGG AATCAACTAG CAACTAAATT GTATGACTAG ATAAACATTA CTTGGCTTGA AAAAATTGAT GTTGCTTCTA
CTTACTCTCA GGATGCAACG TAGGAAGGGT CAATTTGCCG GAAGAGCAAA TATGGAGGGA GAGTCCCTAT CTCCAGGCTG
TGAACTTGCT TCCCAGGGTT CAGGCCAAGA TTTTCTATCT CGAGAATCAA AGTATTTCTT ATCTTTTGAT AGTCTATATA
CTCGTTCTGT CTAATTATTG TTTAGTAGAA GACTTATCTT CTTTCTGTAA AATACTTGTT GCAGGTGTCA GAATTGTGGC
ACTAGTGAAA AAATGACACC GGCAATGCGC CGTGGTCCAG CTGGTCCAAG GACTCTGTGC AACGCCTGCG GACTGATGTG
GGCTAACAAG GTATTGTTGC ATGTATTAAT GAGCTAGTTT ATTGTTTATC TTTCTTTCTG ATAACTAATG GGCTTCTCTT
CATCTTTGTT TTGAGGACAC CTATCCCATT TCATAAATTG ATAGCATTAG AATACAGTAA TATTCTCGTG GAGGTGGATT
GCATAATTAC ATTGCTTGGT TCAACTGGCA AAAACATTCT TCATGGCATG CATGCCTCTT GTTATGGCGT TACAGTACAG
GGCATGTTAA GGCAGTGGCC CTGTTTTGCT ATCTTATGCG GTTGATAATG CACTTGCAGC AATGGTGTAT ATGCAGTACC
AACTAGGGTA AAAAGAGTCA TGGTTTTTGA ACCATATTAT GAAGACATGG ACACATGGTT ATATCTGTCA TATTGTACCT
TTTCTTTTAT TTTTCGTTGG CTTTCTAGGT ACGCCGTTGA CTTCAATAGC TATATGTCAG AATTGCGGGT ATGGTCATTT
TGGAAATTAG GGGGTATACG AAAAAAATAA AAGTAAAGAG AGCCTACCAT TGTTGTTAAT TAAGCCGCTT GTTTCATGTT
ATTGTTGACT GATTCTCTGT GCAAGGAACA TATCTCAAAC ATCACTATGT GACTTCTTAT TCTGATGTTT GCAATTTGCC
TTTGCTGGCA CTAGTCCCTG TGTCTGGTAA TTGCCTAATT GGTATCTGCA GGGTACCCTG AGAAATTGCC CCAAGGCAAA
AGTTGAATCT TCTGTGGTTG CAACTGAGCA GGTTCATTTT TTTAATAATT ATTATCAAGA GTTTGAAAAT GAAATCATTG
CTGAACTGTC AATATTTCCA TACCCGCAGA GCAATGCAGC TGTCTCTCCG AGTGGAATCG ACAACAAGGA ATTGGTGGTA
CCAAACCCTG AAAACATTAC CGCAAGCCAT GGCGAAGTGT AAGTGCCACA TTTCCCGTTC CAAATTTTGT TCAGGCAGAT
GATTTGATTG ACAGTGGATC ATATCCTTTC CAGCATGGGC GACAGCACTC CGGCAAATGA AGCCGAGATA GGAGCGCCAA
AGGCGCAGTC ACAATAAGTT TATGTTTAAC CTGTCATGAT TGAAACCAAA AGATTCTGGA TTCTTTGCCT ACAGGCTATA
CAGCTAAACA TCACAATAGA AGGTCTTTTT CCTGACCAAA GTATACTGAT TCTCCTCAAG TGTACAATTC TTGCTTGCCA
GCACATGTAA ATGTAATTGT AATTAACATA AAGAGCCTGA TTGGTGCCTG TTGTGTAAAC CCCTCATTCT CATGACATCT
AAGATAGCAC ATCAAGCAGA CTGTCATGTA CTTCCGGCTT TGGAGCTGCT TCTGAAGGGG AGTTGTCTGA TGGTGCTTAG
TGTCCCTTCC TAACTACTAC GCCTGTAAAG TTGTACCAAC TGATCCTTGT ACAGTTTGTA TTAATGTGTC GTCTCTGTCT
TTCGTTTTCC 

Locus: Os03g0684000

Loading...

Locus: Os03g0684000

Loading...