Os03t0688300-01

Locus

Os03g0688300

Description

Calcium-dependent protein kinase, Positive regulator of drought stress tolerance and spikelet fertility

RAP-DB Gene Symbol Synonym(s)

CDPK9, OsCDPK9, OsCPK9

RAP-DB Gene Name Synonym(s)

CALCIUM-DEPENDENT PROTEIN KINASE 9, calcium-dependent protein kinase

CGSNL Gene Symbol

CDPK9

CGSNL Gene Name

CALCIUM-DEPENDENT PROTEIN KINASE 9

Oryzabase Gene Symbol Synonym(s)

OsCDPK9, OsCPK9, CPK9

Oryzabase Gene Name Synonym(s)

calcium-dependent protein kinase

Transcript Evidence

AK105102

Protein Evidence

Q6AVI8

Literature

PMID: 24884869

PMID: 15695435

Note

Manual Curation

June 4, 2014

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

EF-hand domain (IPR002048)

EF-hand domain pair (IPR011992)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

EF-Hand 1, calcium-binding site (IPR018247)

Full-length cDNA

001-100-D05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0688300-01)

Others

Oryzabase (8062)

KEGG (Os03t0688300-01 (EC:2.7.11.17))

Transcript

2161 bp

>Os03t0688300-01 Calcium-dependent protein kinase, Positive regulator of drought stress tolerance and spikelet fertility
ATGCTTCTTGTTCATCCAAGCTAAGCTGAGCTGAGCTGAGATGGGCGAGAGATGTAGAAG
TAGATAGAATTAAGCTAGCTAGAGAGGTAGATATATAGCTGTGGTGAGGAAGTTTCCAGA
AGGTTCTAGAAGATCGCCATGGGCAACACGTGCTGCGTCGCTCCGGCTACCACCGATGAG
GTGGGCGCGCCGCCGCGAGATCATCATCACGCGGCCAAGAAGTCGCCGGCGCCGTCGGCG
ACGACGACGACGGCGACGAGGCAGAGGCATGGCCAAGAACCCAAGCCCAAGCCCAAGCCC
AGGGCGAGGGCGAAGCCCAACCCGTACGACTGGGCGCCGCCGCGGGTGCTGCCGGCGAGG
GGCGGCGCCGCCGCGTCCGCGGTGCGCGTGCTGGAGGGCGTGGTGCCGCACCACCCGCGG
CTGCGCGTCACGGACAAGTACCAGCTCGGCCGCGAGCTGGGGCGCGGCGAGTTCGGGGTG
ACGCACCTCGCCACGGACCGCGCGACGCGGGAGCGGCTGGCGTGCAAGTCCATCCCGAAG
CGCCGCCTCCGCACCGCCGTGGACGTCGCCGACGTGCGGCGCGAGGTGGCCATCATGGCG
TCGCTCCCGGACCACCCGGCGCTGGTGCGCCTCCGCGCCGCCTACGAGGACGCCGACGCG
GTGCACCTGGTGATGGAGCTCTGCGACGGCGGCGAGCTGTTCGACCGGATCGTGGCGAGG
GGCCGGTACACGGAGCGCGCCGCGGCCGCCGCGGCGCGGACGGTGGCGGAGGTGGTGCGC
GCGTGCCACGCCCACGGCGTGATGCACCGCGACCTCAAGCCGGAGAACTTCCTCTACGCC
GGCAAGGCCGAGGACGCGCAGCTCAAGGCCATCGATTTCGGCCTCTCCGTCTTCTTCCGA
CCTGGGGAGAGGTTCAGGGAGATCGTGGGGAGCCCGTACTACATGGCGCCGGAGGTGCTC
CGGCGAGACTACGGCCCGGAGGTGGACATCTGGTCCGCCGGCGTCATCCTCTACATCCTC
CTGTGCGGCGTCCCGCCGTTCTGGGCCGAGACGGAGCAGGGCGTGGCGCGCGCCATCCTC
CGCGGCGCCGCCGACTTCGACCGGGAGCCATGGCCGCGCATCTCCCGCGCCGCCAAGTCC
CTCGTCCGCCAGATGCTCGACGTGGACCCGCGCCGCCGCCCCACGGCGCAGCAGGTGCTC
GACCACCCCTGGCTCCACCACGCCGCCCGCGCCCCCAACGTCCCCCTCGGCGACGTCGTC
CGCGCCCGCCTCAAGCAGTTCTCCCTCATGAACCGCCTCAAGAAGAAGGCCATGCGGGTG
ATCGCGGAACACCTGTCGGTAGAGGAGGTGGAGGTGATCAAGGACATGTTCGCGCTCATG
GACACCGACAACAACGGCAGGGTCACGCTCCAGGAGCTCAAGGACGGCCTCACCAAGGTC
GGCTCCAAGCTCGCCGAGCCCGAGATGGAGCTTCTCATGGAGGCCGCGGATGTGGATGGC
AATGGGTACCTGGACTACGGCGAGTTCGTGGCGGTGACCATCCACCTGCAGCGCCTCTCC
AACGACAACCACCTCCGCACGGCCTTCCTCTTCTTCGACAAGGACGGCAGCGGCTACATC
GACCGCGCCGAGCTCGCCGACGCCCTCGCCGACGACTCCGGCCACGCCGACGACGCCGTG
CTCGACCACATCCTTAGAGAAGTCGACACCGACAAGGATGGGCGGATCAGCTACGAGGAG
TTCGTGGCGATGATGAAATCCGGGACGGATTGGAGGAAGGCGTCGCGGCAATACTCGAGG
GAGCGGTTCAAGACGCTCAGCAACAGCCTCATCAAGGACGGCTCGATCACCATGGCGCGC
TAGCTAGCTCGACGAATTCAGTCGATTCAGGCTTGAGAATTCATTGAGAATATGAGGTCG
ATGCAATGCTCGAATTTTTTTTTTTTGATGCATACTTCATTCGAATTTGAATTTGGGTTT
TCCATTTCGTCCAATTTTTCTTTTGTACAATCTACTGTAGATCGATCGGTCGTCTATCTG
AACCTTCTTTGTGTAGGATGTGTTAGTGAACGCTGGGATTGTTTCAGCATTCGTTGTACG
TGTTTGAAATTGCGTCGGGTGTAATTATGTGGTAACGGTGGTAATCAAGCAAATTTACAG
C

CDS

1725 bp

>Os03t0688300-01 Calcium-dependent protein kinase, Positive regulator of drought stress tolerance and spikelet fertility
ATGGGCAACACGTGCTGCGTCGCTCCGGCTACCACCGATGAGGTGGGCGCGCCGCCGCGA
GATCATCATCACGCGGCCAAGAAGTCGCCGGCGCCGTCGGCGACGACGACGACGGCGACG
AGGCAGAGGCATGGCCAAGAACCCAAGCCCAAGCCCAAGCCCAGGGCGAGGGCGAAGCCC
AACCCGTACGACTGGGCGCCGCCGCGGGTGCTGCCGGCGAGGGGCGGCGCCGCCGCGTCC
GCGGTGCGCGTGCTGGAGGGCGTGGTGCCGCACCACCCGCGGCTGCGCGTCACGGACAAG
TACCAGCTCGGCCGCGAGCTGGGGCGCGGCGAGTTCGGGGTGACGCACCTCGCCACGGAC
CGCGCGACGCGGGAGCGGCTGGCGTGCAAGTCCATCCCGAAGCGCCGCCTCCGCACCGCC
GTGGACGTCGCCGACGTGCGGCGCGAGGTGGCCATCATGGCGTCGCTCCCGGACCACCCG
GCGCTGGTGCGCCTCCGCGCCGCCTACGAGGACGCCGACGCGGTGCACCTGGTGATGGAG
CTCTGCGACGGCGGCGAGCTGTTCGACCGGATCGTGGCGAGGGGCCGGTACACGGAGCGC
GCCGCGGCCGCCGCGGCGCGGACGGTGGCGGAGGTGGTGCGCGCGTGCCACGCCCACGGC
GTGATGCACCGCGACCTCAAGCCGGAGAACTTCCTCTACGCCGGCAAGGCCGAGGACGCG
CAGCTCAAGGCCATCGATTTCGGCCTCTCCGTCTTCTTCCGACCTGGGGAGAGGTTCAGG
GAGATCGTGGGGAGCCCGTACTACATGGCGCCGGAGGTGCTCCGGCGAGACTACGGCCCG
GAGGTGGACATCTGGTCCGCCGGCGTCATCCTCTACATCCTCCTGTGCGGCGTCCCGCCG
TTCTGGGCCGAGACGGAGCAGGGCGTGGCGCGCGCCATCCTCCGCGGCGCCGCCGACTTC
GACCGGGAGCCATGGCCGCGCATCTCCCGCGCCGCCAAGTCCCTCGTCCGCCAGATGCTC
GACGTGGACCCGCGCCGCCGCCCCACGGCGCAGCAGGTGCTCGACCACCCCTGGCTCCAC
CACGCCGCCCGCGCCCCCAACGTCCCCCTCGGCGACGTCGTCCGCGCCCGCCTCAAGCAG
TTCTCCCTCATGAACCGCCTCAAGAAGAAGGCCATGCGGGTGATCGCGGAACACCTGTCG
GTAGAGGAGGTGGAGGTGATCAAGGACATGTTCGCGCTCATGGACACCGACAACAACGGC
AGGGTCACGCTCCAGGAGCTCAAGGACGGCCTCACCAAGGTCGGCTCCAAGCTCGCCGAG
CCCGAGATGGAGCTTCTCATGGAGGCCGCGGATGTGGATGGCAATGGGTACCTGGACTAC
GGCGAGTTCGTGGCGGTGACCATCCACCTGCAGCGCCTCTCCAACGACAACCACCTCCGC
ACGGCCTTCCTCTTCTTCGACAAGGACGGCAGCGGCTACATCGACCGCGCCGAGCTCGCC
GACGCCCTCGCCGACGACTCCGGCCACGCCGACGACGCCGTGCTCGACCACATCCTTAGA
GAAGTCGACACCGACAAGGATGGGCGGATCAGCTACGAGGAGTTCGTGGCGATGATGAAA
TCCGGGACGGATTGGAGGAAGGCGTCGCGGCAATACTCGAGGGAGCGGTTCAAGACGCTC
AGCAACAGCCTCATCAAGGACGGCTCGATCACCATGGCGCGCTAG

Protein

575 aa

>Os03t0688300-01 Calcium-dependent protein kinase, Positive regulator of drought stress tolerance and spikelet fertility
MGNTCCVAPATTDEVGAPPRDHHHAAKKSPAPSATTTTATRQRHGQEPKPKPKPRARAKP
NPYDWAPPRVLPARGGAAASAVRVLEGVVPHHPRLRVTDKYQLGRELGRGEFGVTHLATD
RATRERLACKSIPKRRLRTAVDVADVRREVAIMASLPDHPALVRLRAAYEDADAVHLVME
LCDGGELFDRIVARGRYTERAAAAAARTVAEVVRACHAHGVMHRDLKPENFLYAGKAEDA
QLKAIDFGLSVFFRPGERFREIVGSPYYMAPEVLRRDYGPEVDIWSAGVILYILLCGVPP
FWAETEQGVARAILRGAADFDREPWPRISRAAKSLVRQMLDVDPRRRPTAQQVLDHPWLH
HAARAPNVPLGDVVRARLKQFSLMNRLKKKAMRVIAEHLSVEEVEVIKDMFALMDTDNNG
RVTLQELKDGLTKVGSKLAEPEMELLMEAADVDGNGYLDYGEFVAVTIHLQRLSNDNHLR
TAFLFFDKDGSGYIDRAELADALADDSGHADDAVLDHILREVDTDKDGRISYEEFVAMMK
SGTDWRKASRQYSRERFKTLSNSLIKDGSITMAR*

5'UTR

chr03:27467413..27467550 (+ strand) : 138 bp

CDS

chr03:27467551..27468316 (+ strand) : 766 bp

chr03:27471058..27471470 (+ strand) : 413 bp

chr03:27471558..27471725 (+ strand) : 168 bp

chr03:27471795..27472025 (+ strand) : 231 bp

chr03:27472302..27472448 (+ strand) : 147 bp

3'UTR

chr03:27472449..27472746 (+ strand) : 298 bp

FASTA

>Os03t0688300-01 class=Sequence position=chr03:27467413..27472746 (+ strand)
ATGCTTCTTG TTCATCCAAG CTAAGCTGAG CTGAGCTGAG ATGGGCGAGA GATGTAGAAG TAGATAGAAT TAAGCTAGCT
AGAGAGGTAG ATATATAGCT GTGGTGAGGA AGTTTCCAGA AGGTTCTAGA AGATCGCCAT GGGCAACACG TGCTGCGTCG
CTCCGGCTAC CACCGATGAG GTGGGCGCGC CGCCGCGAGA TCATCATCAC GCGGCCAAGA AGTCGCCGGC GCCGTCGGCG
ACGACGACGA CGGCGACGAG GCAGAGGCAT GGCCAAGAAC CCAAGCCCAA GCCCAAGCCC AGGGCGAGGG CGAAGCCCAA
CCCGTACGAC TGGGCGCCGC CGCGGGTGCT GCCGGCGAGG GGCGGCGCCG CCGCGTCCGC GGTGCGCGTG CTGGAGGGCG
TGGTGCCGCA CCACCCGCGG CTGCGCGTCA CGGACAAGTA CCAGCTCGGC CGCGAGCTGG GGCGCGGCGA GTTCGGGGTG
ACGCACCTCG CCACGGACCG CGCGACGCGG GAGCGGCTGG CGTGCAAGTC CATCCCGAAG CGCCGCCTCC GCACCGCCGT
GGACGTCGCC GACGTGCGGC GCGAGGTGGC CATCATGGCG TCGCTCCCGG ACCACCCGGC GCTGGTGCGC CTCCGCGCCG
CCTACGAGGA CGCCGACGCG GTGCACCTGG TGATGGAGCT CTGCGACGGC GGCGAGCTGT TCGACCGGAT CGTGGCGAGG
GGCCGGTACA CGGAGCGCGC CGCGGCCGCC GCGGCGCGGA CGGTGGCGGA GGTGGTGCGC GCGTGCCACG CCCACGGCGT
GATGCACCGC GACCTCAAGC CGGAGAACTT CCTCTACGCC GGCAAGGCCG AGGACGCGCA GCTCAAGGCC ATCGATTTCG
GCCTCTCCGT CTTCTTCCGA CCTGGTCAGC TTCTTCCCTT CTTCTTCCTC TGCAATGCAT GCACGCTTGA ACAAAACTTT
TTTTTTTTTG CCTCTCTTCC CCATTTAATT TTTTTAGAAC ATATTCTCAA AATTTTTTAG TGGTAGTAGA TATTCTCAAA
AATCCCATTC AAAGAATTTT TTTAGAGATT TTCAGTACCT CAAAAAATCC CATTGCAAGA AATTTTGGAG ATTTTCACTA
TATGAAAAAT TGATCTGCAA ATAAATTTGG AGCTTTTCAC AATAATTTTT CACAATCTCA AAGATTGAAA TGTAAATAAA
TTGGGAGCTT TTTCAAAATA TCAAAGATGA AATTGCAAAA AAAAGAGGAT ATTTTTTCCT TCACAATGTC AAAAGATCTA
ATTGCATGAA AACAGAGATT TTCCAGAAAT GCTCAAACTA GTTTTGCAGT TGTTTTTTTG GGTTGCACGT GGATTCTTTG
AGAATTATAA TACTATAAGC ACAGTTGGGA ATAGTTAATT AGTCCCCTGC TACAACTTTT CAAAAGATCC CTTCTGTTAT
AAAAGGTGAA ATTTTATCCC ATTTCTTAAA CACGTTATCT TTTCACGGGT GCCAAATCAT AAAGCACAAA ACACCCCCAA
ATGATCAATG GGTAGGTGGG AGTACATATA AAACCTCAGT AGAGCCTTTT ATGTTTTTAT ATATGAAAAA CATATCTTTA
AGAGAAATTT TATGGTACTT AAAAGAGGTG CTCTCTCCAA TCATTTGTAC TTGACGTTGG AAGAACCAAT CGTAATTCTG
TTAACGTCAA ATATAAATGA ACCGCGAGGG AGGGAGAATC AAATTTTGCA GAGAGAGATA CCGAAAATAC GATGCCTCAT
AAAAAACCGC AAAATCACTC GTATTAAAAA AGAATCATAA ACATCAATAA GAACACATTA TTTCTAACAA AATGTGAACC
CATAGTTGGT CGGCTAACCA ACCCAAATTT GACCCCCTCC CTTAGTAAAT TTGGTGTGCA GTGAAAATAG AACAGGTCGG
CGTTTCGGTG CCCTCTTGCG CCTGAATTTC ACTTTCACCG GTGGAAGAAA TTAAGAACAG TCTGCATTTG AAATGGCAGC
TGATCGTGAC GGTGAGCCGA AAAACCGAGC CAATTCTGCC CGAAATTTTC AGAGAAAAAG TCTGTGGATG CTGGGTCATC
AGATGATGCT ACTCCTCTCT GCAGACACGC ATCACGCCGT CCCCTGTGTT TAGCTTACTC GGTCAGTGAG TTCGTCAACC
TACCACAAAG CTGAATTTCT TTTTTAATTA ACGATAGTAG AAAAGAATAT AAAAGTATAA CCTGAATATT TTTATTTTGA
AAAAAAATGG ATTGGAAAAC CATGTGTTTA TATCTAGACC GAATATACGC AGCCACGAAA AACAGTGATT AAAAAAGAGA
ACAAAATCAC CACCACACGC CGAGTTTTTT TTTTCCATAG TTGCGTCCAG ACTGTTAAGA GGTCGTGGTC GGCAGCAGAT
TGCTGTCAAG ATCTTAATTA AGATAAGCAA GATCGGTGTC AAGGATCTTA CGATAATAGA CGACTCGCTC TTGTTGAGTC
CTCAGGGGAG AAAAAAACTG TCACTCTTGT TCTTAATTAT TGTTCCTCTT TGATGTTGCA TGGCCGAATA GATTGAGCTG
GACAGATCAT TTCAGAATAC AGTCAACTCG TACCGTTATT GCTTGGAATG TAAGAATGGT GGTAAAACAT ATGAATAGCA
AATAAGCAGA GTTTTAATAT AAATACATTT GCATAACAAA GGATCCGTAT AATAAAAGAA GTACAAGAAT TGGATCAGAG
AGACGGGGGT TGTTTtaacc ttactccaaa atattaatgc attgagcagt ccaaaggaat ttcatgagat ttttagatct
ccaatccttt cctcaaataa atggaaagat ttgaattcta caaaactcct tgacaagtcc tttgTTATAA ACAGAGGCTC
TCCATTTTGC ACATTCATGT TCAAGCAAAA AAAAAAgaca ttttgcacat tgacatgatc tttcaaacat aatattgacc
atcactttgc atcataatat atacagtgat aaaattccag tgtattttgc ttatccatct tgaacgttta aaatggattt
ttatttatac cttaagtcta aatgcatatc taaagCATCA AAATATGGGG TTAAGTATAC ATTTGTGGAT AAATTTGTAC
TAACCACAGT ACAATATTTG TGACGAGATA GAGCCTAGTG AGAGTGTGAC TCTGAGATGG GCCGGCCTAC ATGCAATCTG
TGCAGATAGG CCCAGTAGAT TTCATACGGC CCATGTTTCA AATCCAGCCT TTTCTTCAAC CTCACCAAAA AACTAGTTAT
ACATTTGTTG TCAAagatgt aattatagca caattgtgtt gtaactatat tataatttag tatcatgtaa cttgtaagta
actttcaaaa atcaataggc gacatgttat ttccatgaaa tggaggtaat ggaaccgaat tcccttacat gcgtgtgcaa
tgtgattttt tcttatctac cttgcatgaa ttttaaagca aaatcgaacg gtttaaaagt atgtgaaagt tacgtacaaa
ttacattata gttacatgtg tgattacaca tatttacatt tgttaaattt ttatgagaaa atttgccgat aaatatacag
aaaaaAAAGA GAAAAAAAAC TGACTTGGCA AGTGAAAGGA AACAGGGGAG AGGTTCAGGG AGATCGTGGG GAGCCCGTAC
TACATGGCGC CGGAGGTGCT CCGGCGAGAC TACGGCCCGG AGGTGGACAT CTGGTCCGCC GGCGTCATCC TCTACATCCT
CCTGTGCGGC GTCCCGCCGT TCTGGGCCGA GACGGAGCAG GGCGTGGCGC GCGCCATCCT CCGCGGCGCC GCCGACTTCG
ACCGGGAGCC ATGGCCGCGC ATCTCCCGCG CCGCCAAGTC CCTCGTCCGC CAGATGCTCG ACGTGGACCC GCGCCGCCGC
CCCACGGCGC AGCAGGTGCT CGACCACCCC TGGCTCCACC ACGCCGCCCG CGCCCCCAAC GTCCCCCTCG GCGACGTCGT
CCGCGCCCGC CTCAAGCAGT TCTCCCTCAT GAACCGCCTC AAGAAGAAGG CCATGCGGGT ACGTGGCGTG CGTGCTCTGC
TCTTGATGTC GTCTCCGGCG ACGGCGAGCC CGTTTCTGTG TCTGACCGCC CAGCGATGCA CGCAGGTGAT CGCGGAACAC
CTGTCGGTAG AGGAGGTGGA GGTGATCAAG GACATGTTCG CGCTCATGGA CACCGACAAC AACGGCAGGG TCACGCTCCA
GGAGCTCAAG GACGGCCTCA CCAAGGTCGG CTCCAAGCTC GCCGAGCCCG AGATGGAGCT TCTCATGGAG GCCGTAAGCT
TCTTTACCCT TCTTCAAGAT AGCAATGGCG GCAATGGCGA GTTCTTGATT TTGCATTGGC AGGCGGATGT GGATGGCAAT
GGGTACCTGG ACTACGGCGA GTTCGTGGCG GTGACCATCC ACCTGCAGCG CCTCTCCAAC GACAACCACC TCCGCACGGC
CTTCCTCTTC TTCGACAAGG ACGGCAGCGG CTACATCGAC CGCGCCGAGC TCGCCGACGC CCTCGCCGAC GACTCCGGCC
ACGCCGACGA CGCCGTGCTC GACCACATCC TTAGAGAAGT CGACACCGAC AAGGTAAACA CACACGCTTC CCTTCCACTA
CTCCATTTGC AACAAAAATG TTCTTCAATT CAGCTCTATC TCTTTTGAAG CCTagccaga tagtttgaac tccactcaga
attagagtga aattagttga agcgctctta caaaatgaac tggagaaatg taactgggtt tagcctcctc cacaactcca
cttcaaactc ggctctcgga gttaaattta ggcgttagag ctctcccaaa taAACTCTGA AACTGATCAA TCTCTGAATT
TGCATGCAGG ATGGGCGGAT CAGCTACGAG GAGTTCGTGG CGATGATGAA ATCCGGGACG GATTGGAGGA AGGCGTCGCG
GCAATACTCG AGGGAGCGGT TCAAGACGCT CAGCAACAGC CTCATCAAGG ACGGCTCGAT CACCATGGCG CGCTAGCTAG
CTCGACGAAT TCAGTCGATT CAGGCTTGAG AATTCATTGA GAATATGAGG TCGATGCAAT GCTCGAATTT TTTTTTTTTG
ATGCATACTT CATTCGAATT TGAATTTGGG TTTTCCATTT CGTCCAATTT TTCTTTTGTA CAATCTACTG TAGATCGATC
GGTCGTCTAT CTGAACCTTC TTTGTGTAGG ATGTGTTAGT GAACGCTGGG ATTGTTTCAG CATTCGTTGT ACGTGTTTGA
AATTGCGTCG GGTGTAATTA TGTGGTAACG GTGGTAATCA AGCAAATTTA CAGC

Locus: Os03g0688300

Loading...

Locus: Os03g0688300

Loading...