Os03t0693600-01

Locus

Os03g0693600

Description

Glucosyltransferase, Mediation of auxin homeostasis, Regulation of growth and development

RAP-DB Gene Symbol Synonym(s)

OsIAGT1, OsIAAGLU

RAP-DB Gene Name Synonym(s)

indole-3-acetic acid glucosyltransferase

CGSNL Gene Symbol

IAGLU

CGSNL Gene Name

IAA-GLUCOSE SYNTHASE

Oryzabase Gene Symbol Synonym(s)

OsIAGLU, OsIAAGLU, IAAGLU, OsIAGT1, IAGT1, UGT74A2, OsUGT74A2

Oryzabase Gene Name Synonym(s)

IAA-glucose synthase, indole-3-acetic acid glucosyltransferase, IAA-glycosyltransferase, UDP-glucosyltransferase 74A2

Transcript Evidence

Inferred from literature

Protein Evidence

Q851J7

Literature

PMID: 31853664

PMID: 30903268

Note

Manual Curation

December 24, 2019

Gene Ontology (GO)

Molecular Function: transferase activity, transferring hexosyl groups (GO:0016758)

Functional domain (InterPro)

UDP-glucuronosyl/UDP-glucosyltransferase (IPR002213)

UDP-glycosyltransferase family, conserved site (IPR035595)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

Expression Databases

TENOR (Os03t0693600-00)

Others

Oryzabase (12532)

Transcript

1515 bp

>Os03t0693600-01 Glucosyltransferase, Mediation of auxin homeostasis, Regulation of growth and development
ATGGCGCATGTCCTTGTCGTGCCGTATCCTAGCCAGGGGCACATGAACCCGATGGTGCAG
TTCGCGAGGAAGCTGGCGTCCAAGGGCGTGGCGGTGACCGTGGTCACCACCCGCTTCATC
GAGCGGACGACGTCGTCGTCCGCCGGCGGCGGGGGCCTCGACGCCTGCCCGGGGGTGCGG
GTGGAGGTCATCTCCGACGGCCACGACGAGGGCGGCGTCGCGTCGGCGGCGAGCCTGGAG
GAGTACCTCGCCACGCTCGACGCCGCCGGGGCCGCGTCGCTCGCCGGGCTCGTCGCCGCC
GAGGCGCGCGGCGCCGGCGCGGACCGCCTCCCCTTCACGTGCGTGGTGTACGACACGTTC
GCGCCGTGGGCGGGGCGCGTGGCGCGCGGCCTCGGCCTGCCGGCCGTGGCGTTCTCCACG
CAGTCGTGCGCCGTCAGCGCTGTGTACCACTACGTCCACGAGGGGAAGCTCGCCGTgccg
gcgccggagcaggagccggcgaccagcaggagcgccgcgttcgccgggctgccgGAGATG
GAGAGGCGCGAGCTCCCGTCGTTCGTGCTCGGCGACGGGCCGTACCCGACGCTCGCCGTG
TTCGCGCTCAGCCAGTTCGCCGACGCGGGGAAGGACGACTGGGTGCTCTTCAACTCGTTC
GACGAGCTGGAGAGCGAGGTTTTGGCTGGGTTGTCGACCCAGTGGAAGGCCCGCGCCATC
GGGCCATGCGTGCCACTTCCCGCCGGCGACGGCGCCACCGGCCGCTTCACCTACGGCGCG
AACCTGCTCGACCCggaggacacctgcatgcagtggctggacaccaagccgccgagctcc
gtcgcctacgtctccttcggcagcttcgcgtccctcggcgccgcccagacggaggagctc
gcccgcggcctcctcgccgccggcaggccgttcctgtgggtggtcagggccaccgaggag
gcgcagctgccccgccacctcctggacgccgcgacggcgtcgggcgacgcgctcgtcgtg
cggtggagcccccagctcgacgtgctggcgcaccgcgccaccgggtgcttcgtcacgcac
tgcggctggaactccaccctggaggcgctcggcttcggggtgcccatggtggcgatgccg
ctgtggaccgaccagcccaccaacgccCTGCTCGTCGAGCGCGCCTGGGGCGCCGGCGTG
CGCGCCCGCCGCGGCGACGCCGACGCCGACGACGCCGCGGGGGGGACGGCGGCGATGTTC
CTCCGCGGCGACATCGAGCGGTGCGTGCGCGCCGTCATGGACGGGGAGGAGCAGGAGGCC
GCCCGTGCCCGCGCGCGCGGCGAGGCGCGGCGGTGGAGCGACGCCGCGCGCGCGGCGGTG
TCCCCCGGCGGCAGCTCCGACCGGAGCCTGGACGAGTTCGTGGAGTTCTTGCGCGGCGGC
TCCGGCGCCGACGCCGGCGAGAAGTGGAAGACGCTGGTTTGGGAGGGCAGCGAGGCTGCA
GCGTCGGAGATGTGA

CDS

1515 bp

>Os03t0693600-01 Glucosyltransferase, Mediation of auxin homeostasis, Regulation of growth and development
ATGGCGCATGTCCTTGTCGTGCCGTATCCTAGCCAGGGGCACATGAACCCGATGGTGCAG
TTCGCGAGGAAGCTGGCGTCCAAGGGCGTGGCGGTGACCGTGGTCACCACCCGCTTCATC
GAGCGGACGACGTCGTCGTCCGCCGGCGGCGGGGGCCTCGACGCCTGCCCGGGGGTGCGG
GTGGAGGTCATCTCCGACGGCCACGACGAGGGCGGCGTCGCGTCGGCGGCGAGCCTGGAG
GAGTACCTCGCCACGCTCGACGCCGCCGGGGCCGCGTCGCTCGCCGGGCTCGTCGCCGCC
GAGGCGCGCGGCGCCGGCGCGGACCGCCTCCCCTTCACGTGCGTGGTGTACGACACGTTC
GCGCCGTGGGCGGGGCGCGTGGCGCGCGGCCTCGGCCTGCCGGCCGTGGCGTTCTCCACG
CAGTCGTGCGCCGTCAGCGCTGTGTACCACTACGTCCACGAGGGGAAGCTCGCCGTgccg
gcgccggagcaggagccggcgaccagcaggagcgccgcgttcgccgggctgccgGAGATG
GAGAGGCGCGAGCTCCCGTCGTTCGTGCTCGGCGACGGGCCGTACCCGACGCTCGCCGTG
TTCGCGCTCAGCCAGTTCGCCGACGCGGGGAAGGACGACTGGGTGCTCTTCAACTCGTTC
GACGAGCTGGAGAGCGAGGTTTTGGCTGGGTTGTCGACCCAGTGGAAGGCCCGCGCCATC
GGGCCATGCGTGCCACTTCCCGCCGGCGACGGCGCCACCGGCCGCTTCACCTACGGCGCG
AACCTGCTCGACCCggaggacacctgcatgcagtggctggacaccaagccgccgagctcc
gtcgcctacgtctccttcggcagcttcgcgtccctcggcgccgcccagacggaggagctc
gcccgcggcctcctcgccgccggcaggccgttcctgtgggtggtcagggccaccgaggag
gcgcagctgccccgccacctcctggacgccgcgacggcgtcgggcgacgcgctcgtcgtg
cggtggagcccccagctcgacgtgctggcgcaccgcgccaccgggtgcttcgtcacgcac
tgcggctggaactccaccctggaggcgctcggcttcggggtgcccatggtggcgatgccg
ctgtggaccgaccagcccaccaacgccCTGCTCGTCGAGCGCGCCTGGGGCGCCGGCGTG
CGCGCCCGCCGCGGCGACGCCGACGCCGACGACGCCGCGGGGGGGACGGCGGCGATGTTC
CTCCGCGGCGACATCGAGCGGTGCGTGCGCGCCGTCATGGACGGGGAGGAGCAGGAGGCC
GCCCGTGCCCGCGCGCGCGGCGAGGCGCGGCGGTGGAGCGACGCCGCGCGCGCGGCGGTG
TCCCCCGGCGGCAGCTCCGACCGGAGCCTGGACGAGTTCGTGGAGTTCTTGCGCGGCGGC
TCCGGCGCCGACGCCGGCGAGAAGTGGAAGACGCTGGTTTGGGAGGGCAGCGAGGCTGCA
GCGTCGGAGATGTGA

Protein

504 aa

>Os03t0693600-01 Glucosyltransferase, Mediation of auxin homeostasis, Regulation of growth and development
MAHVLVVPYPSQGHMNPMVQFARKLASKGVAVTVVTTRFIERTTSSSAGGGGLDACPGVR
VEVISDGHDEGGVASAASLEEYLATLDAAGAASLAGLVAAEARGAGADRLPFTCVVYDTF
APWAGRVARGLGLPAVAFSTQSCAVSAVYHYVHEGKLAVPAPEQEPATSRSAAFAGLPEM
ERRELPSFVLGDGPYPTLAVFALSQFADAGKDDWVLFNSFDELESEVLAGLSTQWKARAI
GPCVPLPAGDGATGRFTYGANLLDPEDTCMQWLDTKPPSSVAYVSFGSFASLGAAQTEEL
ARGLLAAGRPFLWVVRATEEAQLPRHLLDAATASGDALVVRWSPQLDVLAHRATGCFVTH
CGWNSTLEALGFGVPMVAMPLWTDQPTNALLVERAWGAGVRARRGDADADDAAGGTAAMF
LRGDIERCVRAVMDGEEQEAARARARGEARRWSDAARAAVSPGGSSDRSLDEFVEFLRGG
SGADAGEKWKTLVWEGSEAAASEM*

CDS

chr03:27775340..27776017 (+ strand) : 678 bp

chr03:27777591..27778427 (+ strand) : 837 bp

FASTA

>Os03t0693600-01 class=Sequence position=chr03:27775340..27778427 (+ strand)
ATGGCGCATG TCCTTGTCGT GCCGTATCCT AGCCAGGGGC ACATGAACCC GATGGTGCAG TTCGCGAGGA AGCTGGCGTC
CAAGGGCGTG GCGGTGACCG TGGTCACCAC CCGCTTCATC GAGCGGACGA CGTCGTCGTC CGCCGGCGGC GGGGGCCTCG
ACGCCTGCCC GGGGGTGCGG GTGGAGGTCA TCTCCGACGG CCACGACGAG GGCGGCGTCG CGTCGGCGGC GAGCCTGGAG
GAGTACCTCG CCACGCTCGA CGCCGCCGGG GCCGCGTCGC TCGCCGGGCT CGTCGCCGCC GAGGCGCGCG GCGCCGGCGC
GGACCGCCTC CCCTTCACGT GCGTGGTGTA CGACACGTTC GCGCCGTGGG CGGGGCGCGT GGCGCGCGGC CTCGGCCTGC
CGGCCGTGGC GTTCTCCACG CAGTCGTGCG CCGTCAGCGC TGTGTACCAC TACGTCCACG AGGGGAAGCT CGCCGTgccg
gcgccggagc aggagccggc gaccagcagg agcgccgcgt tcgccgggct gccgGAGATG GAGAGGCGCG AGCTCCCGTC
GTTCGTGCTC GGCGACGGGC CGTACCCGAC GCTCGCCGTG TTCGCGCTCA GCCAGTTCGC CGACGCGGGG AAGGACGACT
GGGTGCTCTT CAACTCGTTC GACGAGCTGG AGAGCGAGGT AAGTGAAGAA TTAATAAACC GGAGATTTAA TGTTTTTCAA
CGAATTTTTA AAGCGTATTA CTATTTTTCA ACTAAATTTT GTCTCGGTGA TTGATTCGTA GTAGCATCAT GGCCCATGCG
TATAGCTTTC TTTGATGGCC TTCATATACG TATAAACTGT TGGCAGTTGG GACAAAGCTG ATAAATCCTT TACATGCCTG
CTTGGAATGT GAGAATGTCA TATGATTTTG GTAGAAAAAA ATGATTGGAT AAATTATTCG AAATCAATTT ACTCTCCTTT
GTCGTACCCA AGTAGATATG CAGAATTCTA GAATTGGATG GGTGCAATGT AGTTCTTATT TATGCATGGG TGTGGGCGCG
GCGTCAGGCT AAAATATTTG GGTTTTTGAT TAATCCCTCT TGTTGATTTG TACTATAAAA AATGATTTAA TTAAATCATT
TTAGCCTGTC CATATGATAC ATTTGGAATG TGATGAGAAT GGCCCGACGC TTTCTGTGGT CGTCACGGTT GTCGTGAAGA
CACGTGTCAC TAAAGTCCTA TTTGAAACAC TAAAGTATTA GGAATTTTAA TTTGGCCGAT CGGTTGTGCT GCTGCCGCTG
CCTCTGTGGC AGTTCATAGC TTTGCGACAA TTGCTATGAA GACACGTGTC ACTAAAGTCT TATTTGAAAC ATGAAAGTAT
ATTAAGAATT TTTTTAGCCG CAATGTATTT TTCAAGGATA CGAAAACAAT GTATTCTTTA AGGATGAAAT TTTAGAGGAT
ACAGTATATA TGCATATGTA GCAAGTGCTC GATGCTCCGG TGTTAGTCTC CTGGTAGTAT TATACTAGGG GGCAAATTAT
TAACTTATTA ATACAATGAT TAGGAGTTAC TTTGTTATTT ACGTTTTTCC TGGCTAAATC TATCTATGAT CATCCATTGT
GTTGACATCG CTCTCATTTC ATCGAAAAAA CCAAAACAGG AAGGAAAAAA AATgtttagt cactgctaaa tgatgattat
atcatctgca tctatttttt cttgacaata atgactgcgt acatttctat taccgttaac tgcggtgata gtataaatag
atctaaacct tttgatcaaa tgaaatcaat ggttcatatt gatttaTACT ACCCGTAGAG AGCACCGTAG TAATGGTCAT
GTAGCAAATA TAGTGTGCAT TTTCAACCTT CACAGTCAAT TTCCTGCCTT ATTTCTTTTT ACGCCAAACT TGGAACGATA
AAATTATTGA AATCCTATAA ATGTCAGAGG AAGGaaatat atagtgcaaa cttagtatgt agtataaatc taaaaaataa
agtataataa agaatagagt ctttcttaaa aaaaataaag tctaatattt gtccaagtta cacggagtaa aactttcgat
ttaacaatga gtaaaagtta tttatagtga ggtaaacaaa tctcagacac atattaaatg ctactatgat aattttcagg
tttatattag gtatgtgatt tgcCAGTGGC CGATTGCACT TGACTCCACA AAATGGACTA ATTGATTAAC ACTCTGATCG
TACTGTTCTA GGTTTTGGCT GGGTTGTCGA CCCAGTGGAA GGCCCGCGCC ATCGGGCCAT GCGTGCCACT TCCCGCCGGC
GACGGCGCCA CCGGCCGCTT CACCTACGGC GCGAACCTGC TCGACCCgga ggacacctgc atgcagtggc tggacaccaa
gccgccgagc tccgtcgcct acgtctcctt cggcagcttc gcgtccctcg gcgccgccca gacggaggag ctcgcccgcg
gcctcctcgc cgccggcagg ccgttcctgt gggtggtcag ggccaccgag gaggcgcagc tgccccgcca cctcctggac
gccgcgacgg cgtcgggcga cgcgctcgtc gtgcggtgga gcccccagct cgacgtgctg gcgcaccgcg ccaccgggtg
cttcgtcacg cactgcggct ggaactccac cctggaggcg ctcggcttcg gggtgcccat ggtggcgatg ccgctgtgga
ccgaccagcc caccaacgcc CTGCTCGTCG AGCGCGCCTG GGGCGCCGGC GTGCGCGCCC GCCGCGGCGA CGCCGACGCC
GACGACGCCG CGGGGGGGAC GGCGGCGATG TTCCTCCGCG GCGACATCGA GCGGTGCGTG CGCGCCGTCA TGGACGGGGA
GGAGCAGGAG GCCGCCCGTG CCCGCGCGCG CGGCGAGGCG CGGCGGTGGA GCGACGCCGC GCGCGCGGCG GTGTCCCCCG
GCGGCAGCTC CGACCGGAGC CTGGACGAGT TCGTGGAGTT CTTGCGCGGC GGCTCCGGCG CCGACGCCGG CGAGAAGTGG
AAGACGCTGG TTTGGGAGGG CAGCGAGGCT GCAGCGTCGG AGATGTGA

Locus: Os03g0693600

Loading...

Locus: Os03g0693600

Loading...