Os03t0696300-01

Locus

Os03g0696300

Description

Similar to Nuclear transcription factor Y subunit A-1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP2D

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2D, NF-YA, CBF-B, NF-YA4, OsNF-YA4, NFYA4

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A4, NUCLEAR FACTOR-Y subunit NF-YA4, NF-YA transcription factor 4, NF-YA subunit 4, NF-YA family 4

Transcript Evidence

AK069854 (DDBJ, Best hit)

Protein Evidence

B6TAR1 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Cellular Component: CCAAT-binding factor complex (GO:0016602)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

CCAAT-binding transcription factor, subunit B (IPR001289)

CCAAT-binding factor, conserved site (IPR018362)

Full-length cDNA

J023036P10 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0696300-01)

Others

Oryzabase (8476)

Transcript

1958 bp

>Os03t0696300-01 Similar to Nuclear transcription factor Y subunit A-1.
ACTGGATCCTGATTGGCGTTGCGGCCAATCAGGATCCTGCTGGATCCTGATTGGATCCTG
ATTGGCGTTGCGGCCGTGTCTCTACTGTTGTTGTTGTTGTGTTTTTTTTTTCTTTTTTAC
CTTTTTTTGCCGCCTTGGTTTTGATGCGGAGTCTGGATGTTTCTACTTTTGGATGGGGTT
TTTTTACCTTACCCGACCGAATTCGTGGGTGGATTGGATGCGGTTCATGGAAGGGAACGG
GATCTTGGTCGGCTACTCGGATGGGGGGTTTGCCGGCCGGTTGGGATTTCGGGAACCGGA
TCGAGGAAGAGGCGGAGGAGAATTGATCCGCGGCGGCGGCGGCGGAGGAGGAGGAGAGAA
TATGTGGTGATTTTCATCTGAGCCCGGTTGCAGAAGTCCAACTGTATCGGAGAATCTTAC
TCGGTTCGTACTACAGTCCCCCACGCTGGTATTCAAGGAATCTTCTCTGGATGGACCAGT
TCTTGGTTGGTCCCGGTTCTTTCATGTCCAGTTCCCCATGGTGGTTCAGTTGGCAGTTGT
GCCCTAGTTGTTGTAGGAGTAATTGTCGGTGGCTTTAAATGGTTCATGCTCGTCAGTTCT
TCCGAGCATTCCGAGGTGAGCGAGCATGGAGTCGAGGCCGGGGGGAACCAACCTCGTGGA
GCCGAGGGGGCAGGGCGCGCTGCCGTCCGGCATACCGATCCAGCAGCCGTGGTGGACGAC
CTCCGCCGGGGTCGGGGCGGTGTCGCCCGCCGTCGTGGCGCCGGGGAGCGGTGCGGGGAT
CAGCCTGTCGGGCAGGGATGGCGGCGGCGACGACGCGGCAGAGGAGAGCAGCGATGACTC
ACGAAGATCAGGGGAGACCAAAGATGGAAGCACTGATCAAGAAAAGCATCATGCAACATC
GCAGATGACTGCTTTGGCATCAGACTATTTAACACCATTTTCACAGCTGGAACTAAACCA
ACCAATTGCTTCGGCAGCATACCAGTACCCTGACTCTTACTATATGGGCATGGTTGGTCC
CTATGGACCTCAAGCTATGTCCGCACAGACTCATTTCCAGCTACCTGGATTAACTCACTC
TCGTATGCCGTTGCCTCTTGAAATATCTGAGGAGCCTGTTTATGTAAATGCTAAGCAATA
TCATGGAATTTTAAGACGGAGGCAGTCACGTGCGAAGGCTGAACTTGAGAAAAAAGTTGT
TAAATCAAGAAAGCCCTATCTTCATGAGTCTCGTCATCAACATGCTATGCGAAGGGCAAG
AGGAACGGGTGGACGCTTCCTGAACACAAAGAAAAATGAAGATGGTGCTCCCAGTGAGAA
AGCCGAACCAAACAAAGGAGAGCAGAACTCCGGGTATCGCCGGATCCCTCCTGACTTACA
GCTCCTACAGAAGGAAACATGAAGTAGCGGCTCGAAACCTAGAACAGTGGCTTCTGTCCA
CCGGCATTCACTCTTGAGGGTGGATTCTTGCTCCAGAATTGTGCTGCCATCTTTCAAATG
ATCTTCATCGTGCAAAGTAATTATATGTACATTCCTCTGAATGATCTATGCACCAATTGT
TGATCCTGGCAGGGTAATAATCTGGATGTATTGAGTCCATCACAGTGCGAATGTCACGGG
TAGATCTGCTGTTTTCAGGCAATTCATTCTTGGCTTTCTATCCCACCCGTTGTTGTTGCA
AGTTAAGCTAGCAGTACTTGTCTCAGTGTCCGTGAGACGTTTGTGTAAGATTAGGTTAAA
CTAGAAGTTGTAATGCTGTATTAAGTGTTTGTATTTCTAATATGAACCGTAACAAGGCCA
GAGCAGAACTCGTTATACATACAAAAATTGATGGCCAGGTCAGTGTTACCGTATTATTAT
GCAATGGCAGAAGCTTGCATAAGGCGTGGTGCCACTCGTTGCTTTGCTGTATGTTTTTGA
GTTTCATTCGATTTATTTTCACTGTTGAGTTTGTGGGT

CDS

783 bp

>Os03t0696300-01 Similar to Nuclear transcription factor Y subunit A-1.
GCGAGCATGGAGTCGAGGCCGGGGGGAACCAACCTCGTGGAGCCGAGGGGGCAGGGCGCG
CTGCCGTCCGGCATACCGATCCAGCAGCCGTGGTGGACGACCTCCGCCGGGGTCGGGGCG
GTGTCGCCCGCCGTCGTGGCGCCGGGGAGCGGTGCGGGGATCAGCCTGTCGGGCAGGGAT
GGCGGCGGCGACGACGCGGCAGAGGAGAGCAGCGATGACTCACGAAGATCAGGGGAGACC
AAAGATGGAAGCACTGATCAAGAAAAGCATCATGCAACATCGCAGATGACTGCTTTGGCA
TCAGACTATTTAACACCATTTTCACAGCTGGAACTAAACCAACCAATTGCTTCGGCAGCA
TACCAGTACCCTGACTCTTACTATATGGGCATGGTTGGTCCCTATGGACCTCAAGCTATG
TCCGCACAGACTCATTTCCAGCTACCTGGATTAACTCACTCTCGTATGCCGTTGCCTCTT
GAAATATCTGAGGAGCCTGTTTATGTAAATGCTAAGCAATATCATGGAATTTTAAGACGG
AGGCAGTCACGTGCGAAGGCTGAACTTGAGAAAAAAGTTGTTAAATCAAGAAAGCCCTAT
CTTCATGAGTCTCGTCATCAACATGCTATGCGAAGGGCAAGAGGAACGGGTGGACGCTTC
CTGAACACAAAGAAAAATGAAGATGGTGCTCCCAGTGAGAAAGCCGAACCAAACAAAGGA
GAGCAGAACTCCGGGTATCGCCGGATCCCTCCTGACTTACAGCTCCTACAGAAGGAAACA
TGA

Protein

261 aa

>Os03t0696300-01 Similar to Nuclear transcription factor Y subunit A-1.
ASMESRPGGTNLVEPRGQGALPSGIPIQQPWWTTSAGVGAVSPAVVAPGSGAGISLSGRD
GGGDDAAEESSDDSRRSGETKDGSTDQEKHHATSQMTALASDYLTPFSQLELNQPIASAA
YQYPDSYYMGMVGPYGPQAMSAQTHFQLPGLTHSRMPLPLEISEEPVYVNAKQYHGILRR
RQSRAKAELEKKVVKSRKPYLHESRHQHAMRRARGTGGRFLNTKKNEDGAPSEKAEPNKG
EQNSGYRRIPPDLQLLQKET*

5'UTR

chr03:27890692..27891306 (+ strand) : 615 bp

chr03:27891477..27891480 (+ strand) : 4 bp

CDS

chr03:27891481..27891724 (+ strand) : 244 bp

chr03:27892412..27892515 (+ strand) : 104 bp

chr03:27892636..27892707 (+ strand) : 72 bp

chr03:27893267..27893440 (+ strand) : 174 bp

chr03:27893639..27893762 (+ strand) : 124 bp

chr03:27893847..27893911 (+ strand) : 65 bp

3'UTR

chr03:27893912..27894467 (+ strand) : 556 bp

FASTA

>Os03t0696300-01 class=Sequence position=chr03:27890692..27894467 (+ strand)
ACTGGATCCT GATTGGCGTT GCGGCCAATC AGGATCCTGC TGGATCCTGA TTGGATCCTG ATTGGCGTTG CGGCCGTGTC
TCTACTGTTG TTGTTGTTGT GTTTTTTTTT TCTTTTTTAC CTTTTTTTGC CGCCTTGGTT TTGATGCGGA GTCTGGATGT
TTCTACTTTT GGATGGGGTT TTTTTACCTT ACCCGACCGA ATTCGTGGGT GGATTGGATG CGGTTCATGG AAGGGAACGG
GATCTTGGTC GGCTACTCGG ATGGGGGGTT TGCCGGCCGG TTGGGATTTC GGGAACCGGA TCGAGGAAGA GGCGGAGGAG
AATTGATCCG CGGCGGCGGC GGCGGAGGAG GAGGAGAGAA TATGTGGTGA TTTTCATCTG AGCCCGGTTG CAGAAGTCCA
ACTGTATCGG AGAATCTTAC TCGGTTCGTA CTACAGTCCC CCACGCTGGT ATTCAAGGAA TCTTCTCTGG ATGGACCAGT
TCTTGGTTGG TCCCGGTTCT TTCATGTCCA GTTCCCCATG GTGGTTCAGT TGGCAGTTGT GCCCTAGTTG TTGTAGGAGT
AATTGTCGGT GGCTTTAAAT GGTTCATGCT CGTCAGTTCT TCCGAGCATT CCGAGGTGTG GAGGAAGGTC AAATCTTGCC
ATTCTATTCA TTCCATTCTA TCCCTGCTTC GTGCTGTCAG ACTTCTGCTG CTGCTGCTGC ATCAATAAAT TTTCCTGGAT
CTCTTCTGCT CAGCTTCGTC TTCGTGCCTT TTTTCTTGCT GCAAACTGAA ACTCTGCCTG AGCAGGTGAG CGAGCATGGA
GTCGAGGCCG GGGGGAACCA ACCTCGTGGA GCCGAGGGGG CAGGGCGCGC TGCCGTCCGG CATACCGATC CAGCAGCCGT
GGTGGACGAC CTCCGCCGGG GTCGGGGCGG TGTCGCCCGC CGTCGTGGCG CCGGGGAGCG GTGCGGGGAT CAGCCTGTCG
GGCAGGGATG GCGGCGGCGA CGACGCGGCA GAGGAGAGCA GCGATGACTC ACGAAGATCA GGGGAGACCA AAGGTATTGT
TCCTTTTCCT TTTTGGAGTG GTTGTAGGTG CTCGGCCCGG TTTTATCTCT GCAATTCGTG CTTGTTTTGG GAACAAATTG
TGCTTGAGTT GAAAAAGGAG ACTAATTCAG ATGTTCCCAA TTAGGAGTGC AAGAGTGTCC TCTTATGGAG GTTGGAATCG
AAAGTAGGCC AACTTTTTGC GTGCTGGTTA AGTACGCTAT GAGCATGGTA GAACTCTGAA GTCTTGGTCA CCTCGTTAAT
CCTGAAACAC TCGTAGGTGT ATCGCTGATC TATCATGCAT TAGCGTTGCA TATGCAGTGG CTGTGGAGCC TGTCGTGTTG
TGCTGATGTT GTACCATTTG TCACTACTCA CTAGATCGTG TTCACTCTGT TGTAGCTGCA CTTGCCTGGT TCTTTGCTTA
AGTAATACCA TCCTATATAC ACAGTCATGC TAAGAAAGAA TGACTTAACT AGAGTAAATT CAGAAAAATG ATGATGTATT
TTAGTTGTTC TTATTATAGT ATCTGACCTT TTTTTCGCAA AATTTTCTGA TCCCTTCGTA TGTATCCGCT AATCATAAAA
TAATTGTTGA TTTTAGGAGT TCCATGCGAA GAGTTTTTAT TTTTTTTTTG CATTGGGTCA ACGCCAAATG TAAAACATGC
TACCTCATTT CAGTACGAAC TAATATTGTT TGAATGCCAG ATGGAAGCAC TGATCAAGAA AAGCATCATG CAACATCGCA
GATGACTGCT TTGGCATCAG ACTATTTAAC ACCATTTTCA CAGCTGGAAC TAAACCAACC AATTGTATGC ATTCTTTCCT
TGTTGAGTTT CTGTTTCTTA TAGATCTTGT TGTGTCTGCA ACTCGTGTAT ACTTTTCCCT GTCAATGTGC TCATTTTCTC
ATGCTCATAT CGGTCATTGT GCAGGCTTCG GCAGCATACC AGTACCCTGA CTCTTACTAT ATGGGCATGG TTGGTCCCTA
TGGACCTCAA GCTATGGTAC CTTTTTCCTT GCCAGTTTAA ATTATCATAA ATCGTCTCCT GCCTGGTATG CAATCCTTAC
TCTCTTGGAG TATGAGATGC AATTTTGGAT CTGAAATATT GAAGAACTGC GGATATTGGA GCAGCTGTCT ATCACTCTAC
CTTAGTGATT TCCCACAAAG GGCTGCTGAA ATTGCAGCGC CCTATTTTAG CTTTTTTCTA GTTTTGTATA AACCATATTT
TTTTAGACAG CTACTAGCAT TTACATTAGG AAACACCAAT AGCCAGAGGG ATTAAGATCA AGAAGACAGA CATCAGGCAT
GGGCACAGAA CTGCACAACT GATAGAGTAA CAAGACCATG GATACACCTG AACCAAAAAC GGACTTTGTG ATTACCAGAA
ATTTGGTTGC TTTCGTAGTA TATGGAAGCC TGAAAGATCT GAATGCTCAA ATGTCTTTAG GTTGACTCCA CCACTTTGGC
TAGACTTAAC GTGGTTTAAC TTTTATAAAG GTTGAATATT TACTAAAACT GTCCTTAGAG AGTTGCTGAA CTTTCTGCAT
TTTTGTTTCC TGCAGTCCGC ACAGACTCAT TTCCAGCTAC CTGGATTAAC TCACTCTCGT ATGCCGTTGC CTCTTGAAAT
ATCTGAGGAG CCTGTTTATG TAAATGCTAA GCAATATCAT GGAATTTTAA GACGGAGGCA GTCACGTGCG AAGGCTGAAC
TTGAGAAAAA AGTTGTTAAA TCAAGAAAGG TTAGTGAAGT TATATCTTGG TTCTCGCCTC CTGCTAATTC TGGAATTTCC
TCCTCTAGAT CGAGTGTTGA GTTTTCAGGA TGATCCTTCC GTGTCCTGGT TGGATGTCTC CCATTTACTG AAGTGTAGAG
CTCGATAATT TGTTAAGCAC TGGCAGTGTT CTGTAGTGAT AGCGGAATTT GGTGTTTGAT ATTGCAGCCC TATCTTCATG
AGTCTCGTCA TCAACATGCT ATGCGAAGGG CAAGAGGAAC GGGTGGACGC TTCCTGAACA CAAAGAAAAA TGAAGATGGT
GCTCCCAGTG AGAAAGCCGA ACCAAACAAA GGTAACAAAA TTGCTTCACT TTGAGAGAAA CAAGTGTCAG TAGGGGTATT
TCCATTTCTG ATGAACAGCT TTGTGTATCC AAAAGGAGAG CAGAACTCCG GGTATCGCCG GATCCCTCCT GACTTACAGC
TCCTACAGAA GGAAACATGA AGTAGCGGCT CGAAACCTAG AACAGTGGCT TCTGTCCACC GGCATTCACT CTTGAGGGTG
GATTCTTGCT CCAGAATTGT GCTGCCATCT TTCAAATGAT CTTCATCGTG CAAAGTAATT ATATGTACAT TCCTCTGAAT
GATCTATGCA CCAATTGTTG ATCCTGGCAG GGTAATAATC TGGATGTATT GAGTCCATCA CAGTGCGAAT GTCACGGGTA
GATCTGCTGT TTTCAGGCAA TTCATTCTTG GCTTTCTATC CCACCCGTTG TTGTTGCAAG TTAAGCTAGC AGTACTTGTC
TCAGTGTCCG TGAGACGTTT GTGTAAGATT AGGTTAAACT AGAAGTTGTA ATGCTGTATT AAGTGTTTGT ATTTCTAATA
TGAACCGTAA CAAGGCCAGA GCAGAACTCG TTATACATAC AAAAATTGAT GGCCAGGTCA GTGTTACCGT ATTATTATGC
AATGGCAGAA GCTTGCATAA GGCGTGGTGC CACTCGTTGC TTTGCTGTAT GTTTTTGAGT TTCATTCGAT TTATTTTCAC
TGTTGAGTTT GTGGGT