Os03t0696300-02

Locus

Os03g0696300

Description

Similar to nuclear transcription factor Y subunit A-1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP2D

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2D, NF-YA, CBF-B, NF-YA4, OsNF-YA4, NFYA4

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A4, NUCLEAR FACTOR-Y subunit NF-YA4, NF-YA transcription factor 4, NF-YA subunit 4, NF-YA family 4

Transcript Evidence

AK099549 (DDBJ, Best hit)

Protein Evidence

B6TAR1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

CCAAT-binding transcription factor, subunit B (IPR001289)

Full-length cDNA

J013033E22 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0696300-02)

RiceXPro (AK099549)

Others

Oryzabase (8476)

KEGG (Os03t0696300-02)

Transcript

642 bp

>Os03t0696300-02 Similar to nuclear transcription factor Y subunit A-1.
CTGAACTTGAGAAAAAAGTTGTTAAATCAAGAAAGCCCTATCTTCATGAGTCTCGTCATC
AACATGCTATGCGAAGGGCAAGAGGAACGGGTGGACGCTTCCTGAACACAAAGAAAAATG
AAGATGGTGCTCCCAGTGAGAAAGCCGAACCAAACAAAGGAGAGCAGAACTCCGGGTATC
GCCGGATCCCTCCTGACTTACAGCTCCTACAGAAGGAAACATGAAGTAGCGGCTCGAAAC
CTAGAACAGTGGCTTCTGTCCACCGGCATTCACTCTTGAGGGTGGATTCTTGCTCCAGAA
TTGTGCTGCCATCTTTCAAATGATCTTCATCGTGCAAAGTAATTATATGTACATTCCTCT
GAATGATCTATGCACCAATTGTTGATCCTGGCAGGGTAATAATCTGGATGTATTGAGTCC
ATCACAGTGCGAATGTCACGGGTAGATCTGCTGTTTTCAGGCAATTCATTCTTGGCTTTC
TATCCCACCCGTTGTTGTTGCAAGTTAAGCTAGCAGTACTTGTCTCAGTGTCCGTGAGAC
GTTTGTGTAAGATTAGGTTAAACTAGAAGTTGTAATGCTGTATTAAGTGTTTGTATTTCT
AATATGAACCGTAACAAGGCCAGAGCAGAACTCGTTATACAT

CDS

222 bp

>Os03t0696300-02 Similar to nuclear transcription factor Y subunit A-1.
GAACTTGAGAAAAAAGTTGTTAAATCAAGAAAGCCCTATCTTCATGAGTCTCGTCATCAA
CATGCTATGCGAAGGGCAAGAGGAACGGGTGGACGCTTCCTGAACACAAAGAAAAATGAA
GATGGTGCTCCCAGTGAGAAAGCCGAACCAAACAAAGGAGAGCAGAACTCCGGGTATCGC
CGGATCCCTCCTGACTTACAGCTCCTACAGAAGGAAACATGA

Protein

74 aa

>Os03t0696300-02 Similar to nuclear transcription factor Y subunit A-1.
ELEKKVVKSRKPYLHESRHQHAMRRARGTGGRFLNTKKNEDGAPSEKAEPNKGEQNSGYR
RIPPDLQLLQKET*

5'UTR

chr03:27893406..27893407 (+ strand) : 2 bp

CDS

chr03:27893408..27893440 (+ strand) : 33 bp

chr03:27893639..27893762 (+ strand) : 124 bp

chr03:27893847..27893911 (+ strand) : 65 bp

3'UTR

chr03:27893912..27894329 (+ strand) : 418 bp

FASTA

>Os03t0696300-02 class=Sequence position=chr03:27893406..27894329 (+ strand)
CTGAACTTGA GAAAAAAGTT GTTAAATCAA GAAAGGTTAG TGAAGTTATA TCTTGGTTCT CGCCTCCTGC TAATTCTGGA
ATTTCCTCCT CTAGATCGAG TGTTGAGTTT TCAGGATGAT CCTTCCGTGT CCTGGTTGGA TGTCTCCCAT TTACTGAAGT
GTAGAGCTCG ATAATTTGTT AAGCACTGGC AGTGTTCTGT AGTGATAGCG GAATTTGGTG TTTGATATTG CAGCCCTATC
TTCATGAGTC TCGTCATCAA CATGCTATGC GAAGGGCAAG AGGAACGGGT GGACGCTTCC TGAACACAAA GAAAAATGAA
GATGGTGCTC CCAGTGAGAA AGCCGAACCA AACAAAGGTA ACAAAATTGC TTCACTTTGA GAGAAACAAG TGTCAGTAGG
GGTATTTCCA TTTCTGATGA ACAGCTTTGT GTATCCAAAA GGAGAGCAGA ACTCCGGGTA TCGCCGGATC CCTCCTGACT
TACAGCTCCT ACAGAAGGAA ACATGAAGTA GCGGCTCGAA ACCTAGAACA GTGGCTTCTG TCCACCGGCA TTCACTCTTG
AGGGTGGATT CTTGCTCCAG AATTGTGCTG CCATCTTTCA AATGATCTTC ATCGTGCAAA GTAATTATAT GTACATTCCT
CTGAATGATC TATGCACCAA TTGTTGATCC TGGCAGGGTA ATAATCTGGA TGTATTGAGT CCATCACAGT GCGAATGTCA
CGGGTAGATC TGCTGTTTTC AGGCAATTCA TTCTTGGCTT TCTATCCCAC CCGTTGTTGT TGCAAGTTAA GCTAGCAGTA
CTTGTCTCAG TGTCCGTGAG ACGTTTGTGT AAGATTAGGT TAAACTAGAA GTTGTAATGC TGTATTAAGT GTTTGTATTT
CTAATATGAA CCGTAACAAG GCCAGAGCAG AACTCGTTAT ACAT