Os03t0700400-01

Locus

Os03g0700400

Description

Lipoxygenase-3, Generation of stale flavor

RAP-DB Gene Symbol Synonym(s)

LOX-3

RAP-DB Gene Name Synonym(s)

lipoxygenase-3

CGSNL Gene Symbol

LOX3

CGSNL Gene Name

LIPOXYGENASE 3

Oryzabase Gene Symbol Synonym(s)

Lox3*, lox3(t), LOX-3, Lox3, OsLOX4, LOX4

Oryzabase Gene Name Synonym(s)

Lipoxygenase3, Lipoxygenase 3, Lipoxygenase-3, Putative lipoxygenase 3, Lipoxygenase 4

Transcript Evidence

Inferred from literature

Protein Evidence

Q7G794

Literature

DOI: 10.1270/jsbbs.58.169

Note

Manual Curation

May 16, 2018

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: protein binding (GO:0005515)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (GO:0016702)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

PLAT/LH2 domain superfamily (IPR036392)

Lipoxigenase, C-terminal domain superfamily (IPR036226)

Lipoxygenase, domain 3 (IPR027433)

Lipoxygenase, plant (IPR001246)

PLAT/LH2 domain (IPR001024)

Lipoxygenase, C-terminal (IPR013819)

Lipoxygenase, iron binding site (IPR020833)

Lipoxygenase, conserved site (IPR020834)

Expression Databases

TENOR (Os03t0700400-00)

Others

Oryzabase (182)

KEGG (Os03t0700400-00 (EC:1.13.11.58))

Transcript

2601 bp

>Os03t0700400-01 Lipoxygenase-3, Generation of stale flavor
ATGCTGGGAGGGATCATCGACACCATCACGGGGTCGTCGAAGCAGTCGCGGCTCAAGGGC
ACGGTGGTGCTCATGCGCAAGAACGTCCTCGACCTCAACGACTTCGGCGCCACCGTCATC
GACGGCCTCGGCGAGTTCCTCGGCAAGGGCGTCACCTGCCAGCTCATCAGCTCCACCGCC
GTCGACCCAAACAACGGCAACCGGGGGAAGGTGGGGGCGGAGGCGAGCCTGGAGCAGTGG
CTGACGAGCAGCCTGCCGTCGCTGACGACGGGGGAGTCGCGGTTCGGCGTGACGTTCGAC
TGGGACGTCGACAAGCTCGGCGTGCCGGGGGCCATCATCGTCAAGAACCACCACAGCAAC
GAGTTCTTCCTCAAGACCATCACCCTCGACGACGTCCCCGGCCGCGCCGGCGCCGTCGTC
TTCCTCGCCAACTCCTGGGTCTACCCCGCCGACAAGTACCGTTACGACCGCGTCTTCTTC
GCCAACGATGCCTACCTGCCGAGCCAGATGCCGGCGGCGCTGAAGCCGTACCGCGACGAC
GAGCTCCGCAACCTGCGCGGCGACGACCAGCAGGGCCCCTACGAGGAGCACGACCGCGTC
TACCGCTACGATGTCTACAACGACCTCGGCTCCCCCGACTCCGGCAACCCTCGCCCCATC
CTCGGCGGCTCCCCCGACACCCCCTACCCTCGCCGCGGCCGCACCGGCCGCAAACCCACC
ACCACCGATCCGGACTCGGAGAGTAGGCTGTCGCTGGTGGAGCAGATCTACGTGCCGCGG
GACGAGCGGTTCGGGCACCTGAAGATGGCGGACTTCCTGGGCTACTCGATCAAGGCGATC
GCGGAGGGGATCGTGCCGGCGATCCGCACGTACGTGGACACCACCCCCGGCGAGTTCGAC
TCGTTCCAGGACATCCTCGACCTGTACGAGGGTGGCCTCAAGCTCCCCGATGTCCCCGCG
CTGGAGGAGCTCCGCAAGCGATTCCCGCTCCAGCTCGTCAAGGACCTCCTCCCTGCCGCC
GGCGACTATATCCTCAAGCTCCCCATGCCTCAGATTATCAAACAGGACAAGGAGGCGTGG
AGGACAGACGAGGAGTTCGCGCGGGAGGTGCTCGCCGGCGTGAACCCGATGATGATCACG
CGTCTCACGGAATTCCCTCCGAAAAGTAGTCTCGATCCTAGCAAGTTCGGCGACCACACC
AGCATGATCACGGCGGCGCACATCGGGAGCAACCTCGAGGGCCTCACCGTGCAGCAGGCG
CTGGACAGCAACCGGCTGTACATTCTGGACCACCACGACCGGTTCATGCCGTTCCTGATC
GACGTCAACGGCCTGGAGGGCAACTTCATCTACGCGACCAGGACGCTCTTCTTCCTGCGA
GGGGACGGCACGCTGGCGCCGCTCGCCATCGAGCTGAGCGAGCCTATGATCCAGGGCGAC
GTCACCGCCGCCAAGAGCACCGTGTACACGCCGGCGTCCACCGGCGTCGAGGCCTGGGTG
TGGCAGCTCGCCAAGGCCTACGTCGCCGTCAACGACTCCGGCTGGCACCAACTGATCAGC
CACTGGCTGAACACGCACGCTGTGATGGAGCCGTTCGTGATCGCGACGAACCGGCAGCTC
AGCGTGACGCACCCGGTGCACAAGCTGCTGAGCCCGCACTACCGCGACACGATGACCATC
AACGCCCTGGCGCGGCAGACGCTCATCAACGCCGGCGGCATCTTCGAGATGACCGTCTTC
CCCGGCAAGTACGCGCTCTGGATGTCGTCCATGGTGTACAAGAACTGGAACTTCACCGAG
CAGGGCCTCCCCGCCGATCTCATCAAAAGGGGAGTGGCGGTGGAGGACGCGACGAGCCCG
TACAAGGTGCGGCTGCTGATCAAGGACTACCCGTACGCGGCGGACGGGCTGGAGATCTGG
CACGCGATCGAGCAGTGGGTGGGCGAGTACCTGGCGATCTACTACACCGACGACGGCGTG
CTCCGAGGCGACGCGGAGCTGCAGGCGTGGTGGGCGGAGGTGCGGGAGGTCGGGCACGGC
GACCTCAAGGGCGCGGCGTGGTGGCCCAGGATGGACGCCGTGTCGGAGCTCCGCGACGCG
TGCACCACCATCATCTGGATCGCGTCGGCGCTGCACGCGGCGGTCAACTTCGGCCAGTAC
CCGTACGCCGGTTACCTCCCGAACCGGCCGACGGTGAGCCGGCGGCGGATGCCGGAGCCC
GGGACGGAGGCGTACGGCGAGCTGGGGCGCGACCCGGAGCGGGCCTTCATCCGCACCATC
ACCAGCCAGCTCCAGACCATCATCGGCATCTCGCTGATCGAGGTCCTGTCCAAGCACTCC
TCCGACGAGGTGTACCTCGGGCAGCGCGACACGCCGGCGTGGACGTCGGACGCCAGGGCG
CTGGAGGCGTTCCGGCGGTTCAGCGACCGGCTGGTGGAGATCGAAGGGAAGGTGGTGGGC
ATGAACGGCGACGCGGGGCTCAAGAACCGCAATGGCCCAGCCGAGTTCCCATACATGCTG
CTTTACCCCAACACCTCCGACGTCACCGGCGCCGCCGCCGGCATCACCGCCAAGGGCATC
CCCAACAGCATCTCGATCTGA

CDS

2601 bp

>Os03t0700400-01 Lipoxygenase-3, Generation of stale flavor
ATGCTGGGAGGGATCATCGACACCATCACGGGGTCGTCGAAGCAGTCGCGGCTCAAGGGC
ACGGTGGTGCTCATGCGCAAGAACGTCCTCGACCTCAACGACTTCGGCGCCACCGTCATC
GACGGCCTCGGCGAGTTCCTCGGCAAGGGCGTCACCTGCCAGCTCATCAGCTCCACCGCC
GTCGACCCAAACAACGGCAACCGGGGGAAGGTGGGGGCGGAGGCGAGCCTGGAGCAGTGG
CTGACGAGCAGCCTGCCGTCGCTGACGACGGGGGAGTCGCGGTTCGGCGTGACGTTCGAC
TGGGACGTCGACAAGCTCGGCGTGCCGGGGGCCATCATCGTCAAGAACCACCACAGCAAC
GAGTTCTTCCTCAAGACCATCACCCTCGACGACGTCCCCGGCCGCGCCGGCGCCGTCGTC
TTCCTCGCCAACTCCTGGGTCTACCCCGCCGACAAGTACCGTTACGACCGCGTCTTCTTC
GCCAACGATGCCTACCTGCCGAGCCAGATGCCGGCGGCGCTGAAGCCGTACCGCGACGAC
GAGCTCCGCAACCTGCGCGGCGACGACCAGCAGGGCCCCTACGAGGAGCACGACCGCGTC
TACCGCTACGATGTCTACAACGACCTCGGCTCCCCCGACTCCGGCAACCCTCGCCCCATC
CTCGGCGGCTCCCCCGACACCCCCTACCCTCGCCGCGGCCGCACCGGCCGCAAACCCACC
ACCACCGATCCGGACTCGGAGAGTAGGCTGTCGCTGGTGGAGCAGATCTACGTGCCGCGG
GACGAGCGGTTCGGGCACCTGAAGATGGCGGACTTCCTGGGCTACTCGATCAAGGCGATC
GCGGAGGGGATCGTGCCGGCGATCCGCACGTACGTGGACACCACCCCCGGCGAGTTCGAC
TCGTTCCAGGACATCCTCGACCTGTACGAGGGTGGCCTCAAGCTCCCCGATGTCCCCGCG
CTGGAGGAGCTCCGCAAGCGATTCCCGCTCCAGCTCGTCAAGGACCTCCTCCCTGCCGCC
GGCGACTATATCCTCAAGCTCCCCATGCCTCAGATTATCAAACAGGACAAGGAGGCGTGG
AGGACAGACGAGGAGTTCGCGCGGGAGGTGCTCGCCGGCGTGAACCCGATGATGATCACG
CGTCTCACGGAATTCCCTCCGAAAAGTAGTCTCGATCCTAGCAAGTTCGGCGACCACACC
AGCATGATCACGGCGGCGCACATCGGGAGCAACCTCGAGGGCCTCACCGTGCAGCAGGCG
CTGGACAGCAACCGGCTGTACATTCTGGACCACCACGACCGGTTCATGCCGTTCCTGATC
GACGTCAACGGCCTGGAGGGCAACTTCATCTACGCGACCAGGACGCTCTTCTTCCTGCGA
GGGGACGGCACGCTGGCGCCGCTCGCCATCGAGCTGAGCGAGCCTATGATCCAGGGCGAC
GTCACCGCCGCCAAGAGCACCGTGTACACGCCGGCGTCCACCGGCGTCGAGGCCTGGGTG
TGGCAGCTCGCCAAGGCCTACGTCGCCGTCAACGACTCCGGCTGGCACCAACTGATCAGC
CACTGGCTGAACACGCACGCTGTGATGGAGCCGTTCGTGATCGCGACGAACCGGCAGCTC
AGCGTGACGCACCCGGTGCACAAGCTGCTGAGCCCGCACTACCGCGACACGATGACCATC
AACGCCCTGGCGCGGCAGACGCTCATCAACGCCGGCGGCATCTTCGAGATGACCGTCTTC
CCCGGCAAGTACGCGCTCTGGATGTCGTCCATGGTGTACAAGAACTGGAACTTCACCGAG
CAGGGCCTCCCCGCCGATCTCATCAAAAGGGGAGTGGCGGTGGAGGACGCGACGAGCCCG
TACAAGGTGCGGCTGCTGATCAAGGACTACCCGTACGCGGCGGACGGGCTGGAGATCTGG
CACGCGATCGAGCAGTGGGTGGGCGAGTACCTGGCGATCTACTACACCGACGACGGCGTG
CTCCGAGGCGACGCGGAGCTGCAGGCGTGGTGGGCGGAGGTGCGGGAGGTCGGGCACGGC
GACCTCAAGGGCGCGGCGTGGTGGCCCAGGATGGACGCCGTGTCGGAGCTCCGCGACGCG
TGCACCACCATCATCTGGATCGCGTCGGCGCTGCACGCGGCGGTCAACTTCGGCCAGTAC
CCGTACGCCGGTTACCTCCCGAACCGGCCGACGGTGAGCCGGCGGCGGATGCCGGAGCCC
GGGACGGAGGCGTACGGCGAGCTGGGGCGCGACCCGGAGCGGGCCTTCATCCGCACCATC
ACCAGCCAGCTCCAGACCATCATCGGCATCTCGCTGATCGAGGTCCTGTCCAAGCACTCC
TCCGACGAGGTGTACCTCGGGCAGCGCGACACGCCGGCGTGGACGTCGGACGCCAGGGCG
CTGGAGGCGTTCCGGCGGTTCAGCGACCGGCTGGTGGAGATCGAAGGGAAGGTGGTGGGC
ATGAACGGCGACGCGGGGCTCAAGAACCGCAATGGCCCAGCCGAGTTCCCATACATGCTG
CTTTACCCCAACACCTCCGACGTCACCGGCGCCGCCGCCGGCATCACCGCCAAGGGCATC
CCCAACAGCATCTCGATCTGA

Protein

867 aa

>Os03t0700400-01 Lipoxygenase-3, Generation of stale flavor
MLGGIIDTITGSSKQSRLKGTVVLMRKNVLDLNDFGATVIDGLGEFLGKGVTCQLISSTA
VDPNNGNRGKVGAEASLEQWLTSSLPSLTTGESRFGVTFDWDVDKLGVPGAIIVKNHHSN
EFFLKTITLDDVPGRAGAVVFLANSWVYPADKYRYDRVFFANDAYLPSQMPAALKPYRDD
ELRNLRGDDQQGPYEEHDRVYRYDVYNDLGSPDSGNPRPILGGSPDTPYPRRGRTGRKPT
TTDPDSESRLSLVEQIYVPRDERFGHLKMADFLGYSIKAIAEGIVPAIRTYVDTTPGEFD
SFQDILDLYEGGLKLPDVPALEELRKRFPLQLVKDLLPAAGDYILKLPMPQIIKQDKEAW
RTDEEFAREVLAGVNPMMITRLTEFPPKSSLDPSKFGDHTSMITAAHIGSNLEGLTVQQA
LDSNRLYILDHHDRFMPFLIDVNGLEGNFIYATRTLFFLRGDGTLAPLAIELSEPMIQGD
VTAAKSTVYTPASTGVEAWVWQLAKAYVAVNDSGWHQLISHWLNTHAVMEPFVIATNRQL
SVTHPVHKLLSPHYRDTMTINALARQTLINAGGIFEMTVFPGKYALWMSSMVYKNWNFTE
QGLPADLIKRGVAVEDATSPYKVRLLIKDYPYAADGLEIWHAIEQWVGEYLAIYYTDDGV
LRGDAELQAWWAEVREVGHGDLKGAAWWPRMDAVSELRDACTTIIWIASALHAAVNFGQY
PYAGYLPNRPTVSRRRMPEPGTEAYGELGRDPERAFIRTITSQLQTIIGISLIEVLSKHS
SDEVYLGQRDTPAWTSDARALEAFRRFSDRLVEIEGKVVGMNGDAGLKNRNGPAEFPYML
LYPNTSDVTGAAAGITAKGIPNSISI*

CDS

chr03:28090066..28090255 (+ strand) : 190 bp

chr03:28090654..28090952 (+ strand) : 299 bp

chr03:28091639..28091876 (+ strand) : 238 bp

chr03:28092134..28092469 (+ strand) : 336 bp

chr03:28092558..28092643 (+ strand) : 86 bp

chr03:28092739..28092846 (+ strand) : 108 bp

chr03:28092954..28093261 (+ strand) : 308 bp

chr03:28093340..28093603 (+ strand) : 264 bp

chr03:28093696..28094467 (+ strand) : 772 bp

FASTA

>Os03t0700400-01 class=Sequence position=chr03:28090066..28094467 (+ strand)
ATGCTGGGAG GGATCATCGA CACCATCACG GGGTCGTCGA AGCAGTCGCG GCTCAAGGGC ACGGTGGTGC TCATGCGCAA
GAACGTCCTC GACCTCAACG ACTTCGGCGC CACCGTCATC GACGGCCTCG GCGAGTTCCT CGGCAAGGGC GTCACCTGCC
AGCTCATCAG CTCCACCGCC GTCGACCCAA GTGAGCACAC CCCCCCCCCC CCTCTCACCC CCTTGCATCT CTTCTCTTGG
TCGATTTACC TCTCTTGTTC ATTTTTGTCC ATACAAACTT AAACACTGTA TGGGCGGCCA TTGCCTAGCT AGCTCGGTCC
TCTTTTGATG GGACATGGAA AGAAGAGACC AACGTCGAGG AAAAAGACAA CCAGGGCAGG AGTACCAGAT GCTAACCCAA
AGTACAAAAG CTAAAAAGTA AAAAAAAAAA GAAGAAGTAG TACCTCACTT TGAACTAGAT GCCTGAAACT ATAGCTGGTG
TCGCGAGGTG GTGACACGTA GTATAATTAA CAGCTGGGGC ATGATTAGTC GTTGGTTTGG ACTAATTAAC GGGAACGGAT
TGGGCATGAT CCTCTCATCG GCGTGCAGAC AACGGCAACC GGGGGAAGGT GGGGGCGGAG GCGAGCCTGG AGCAGTGGCT
GACGAGCAGC CTGCCGTCGC TGACGACGGG GGAGTCGCGG TTCGGCGTGA CGTTCGACTG GGACGTCGAC AAGCTCGGCG
TGCCGGGGGC CATCATCGTC AAGAACCACC ACAGCAACGA GTTCTTCCTC AAGACCATCA CCCTCGACGA CGTCCCCGGC
CGCGCCGGCG CCGTCGTCTT CCTCGCCAAC TCCTGGGTCT ACCCCGCCGA CAAGTACCGT TACGACCGCG TCTTCTTCGC
CAACGATGTG AGTTCTTCTC TGCTGCATAC TGTATTATGC TACCCTGCAT GTAAATTACA CTATTACAGT AACCATTTGC
CGTTCTTCTT TGTTTGGCCA GTTCGTAGAT GCTTTATGTA GTAAGTTGCT TGATTCACGT CGTTTGGTAG GCGTCCATAG
GGAAGATATT TGGTTAGGTG AGAAGTGAAT GGACTTTATG TAAGTTGTTT ATGTGGTAGG TGAAGTGGAT TTAGTAGCAC
TGTTCAAAAA AAAGAAGCAG CTCTACAATG GATATGCTTC CTGATGATAA CAACATAAAA GTGGCTATAG TACTAGAAAT
CTGGAATAGT CCTTGGACTC AGGAAGGCAT GTGAGTTCAC GTGAGTCATC AACTCATCAT AGTTGCCACA GTTCACAGTT
CACACCCATT TAGACGGCAT TGTTTCATGG CCCCGAGAAG CTTTTTCAAC AAGATCAACG ACACAGCACT CGATTTTACT
TTGCGAACAC ATGACACGGT AAAAGTTTTA AAGTGAACAG ATAGTTGCCT GCCTCTTGTT CAGCGTGCAG CCAGGTGTCC
AAGGCCGGTG CCGTATCAAG GGACTGATTT GGGCAATCAA CTAACCAATT AAGTAGGAGT AATTAGCGAT GCGTATTAAT
ACGAGTACGT GCTATAATTA ACTTTGTGAT ATATTTTCTG CGGCGACGCG CAGGCCTACC TGCCGAGCCA GATGCCGGCG
GCGCTGAAGC CGTACCGCGA CGACGAGCTC CGCAACCTGC GCGGCGACGA CCAGCAGGGC CCCTACGAGG AGCACGACCG
CGTCTACCGC TACGATGTCT ACAACGACCT CGGCTCCCCC GACTCCGGCA ACCCTCGCCC CATCCTCGGC GGCTCCCCCG
ACACCCCCTA CCCTCGCCGC GGCCGCACCG GCCGCAAACC CACCACCACC GGTACGCATC CCCCAACCAA AAATTTTACG
ATTCTTAAAA AAACATTTTA AGGTCTAAAA AGTTTTTTAT ACATTTTTAC ACTAGAATGT GGCACCTTCA CTCACATACC
TCCCAGTTAG GCCCACCTGT CATAGTGAAA CACCAGAACT GGTCCATGTT CAGCTGCAAT GTCTCACTGA CGGTGGGCCC
GGTTTGTGTG GTTGACCGTT GACTTTGACT TTGACTGATG TTTTTTGTAC ACGTATGCGT GCGTGCAGAT CCGGACTCGG
AGAGTAGGCT GTCGCTGGTG GAGCAGATCT ACGTGCCGCG GGACGAGCGG TTCGGGCACC TGAAGATGGC GGACTTCCTG
GGCTACTCGA TCAAGGCGAT CGCGGAGGGG ATCGTGCCGG CGATCCGCAC GTACGTGGAC ACCACCCCCG GCGAGTTCGA
CTCGTTCCAG GACATCCTCG ACCTGTACGA GGGTGGCCTC AAGCTCCCCG ATGTCCCCGC GCTGGAGGAG CTCCGCAAGC
GATTCCCGCT CCAGCTCGTC AAGGACCTCC TCCCTGCCGC CGGCGACTAT ATCCTCAAGC TCCCCATGCC TCAGATTATC
AAACGTGAGC GCAACCTGTC ATCGTAGAGA CTTTTCATCA GAATCTTTAG GTGAAAACTG ACGATCGATG TAATGTTTGG
CTATGTATGC AGAGGACAAG GAGGCGTGGA GGACAGACGA GGAGTTCGCG CGGGAGGTGC TCGCCGGCGT GAACCCGATG
ATGATCACGC GTCTCACGGT GAGTGATCAG TGATGCGTTC ATGCCAAATT GATAGTGAAC ACGGCTGCTG CAACGTGAAA
TGTGGCAAAT TTAACTCGAT GTTGATCCCG CAGGAATTCC CTCCGAAAAG TAGTCTCGAT CCTAGCAAGT TCGGCGACCA
CACCAGCATG ATCACGGCGG CGCACATCGG GAGCAACCTC GAGGGCCTCA CCGTGCAGCA GGTTGGTTTC GTACGTGCAG
ATTTTGCTAT CAATCGTGAC TTGCAAACCT GAATTGTTGC TGGCAAATGG CAATAGTGTG TGGAAATTTA CTGTGTCGCG
ATTTGCAGGC GCTGGACAGC AACCGGCTGT ACATTCTGGA CCACCACGAC CGGTTCATGC CGTTCCTGAT CGACGTCAAC
GGCCTGGAGG GCAACTTCAT CTACGCGACC AGGACGCTCT TCTTCCTGCG AGGGGACGGC ACGCTGGCGC CGCTCGCCAT
CGAGCTGAGC GAGCCTATGA TCCAGGGCGA CGTCACCGCC GCCAAGAGCA CCGTGTACAC GCCGGCGTCC ACCGGCGTCG
AGGCCTGGGT GTGGCAGCTC GCCAAGGCCT ACGTCGCCGT CAACGACTCC GGCTGGCACC AACTGATCAG CCACTGGTAC
GTTCAAAACC AGAGCAATCG ATCGCTTCAT CGACGGAGAT TTGTACTCAT CGGTTGTTGT TGTTGGTTGA TCAGGCTGAA
CACGCACGCT GTGATGGAGC CGTTCGTGAT CGCGACGAAC CGGCAGCTCA GCGTGACGCA CCCGGTGCAC AAGCTGCTGA
GCCCGCACTA CCGCGACACG ATGACCATCA ACGCCCTGGC GCGGCAGACG CTCATCAACG CCGGCGGCAT CTTCGAGATG
ACCGTCTTCC CCGGCAAGTA CGCGCTCTGG ATGTCGTCCA TGGTGTACAA GAACTGGAAC TTCACCGAGC AGGGCCTCCC
CGCCGATCTC ATCAAAAGGT AGTAGTATTA CACATCTCCA TTGATTTTTG TAAGGCATCA GTGGGAAGAA TGTACAATTT
AGTGCAAAAT CGTGTGAATT TTTTTTGCAG GGGAGTGGCG GTGGAGGACG CGACGAGCCC GTACAAGGTG CGGCTGCTGA
TCAAGGACTA CCCGTACGCG GCGGACGGGC TGGAGATCTG GCACGCGATC GAGCAGTGGG TGGGCGAGTA CCTGGCGATC
TACTACACCG ACGACGGCGT GCTCCGAGGC GACGCGGAGC TGCAGGCGTG GTGGGCGGAG GTGCGGGAGG TCGGGCACGG
CGACCTCAAG GGCGCGGCGT GGTGGCCCAG GATGGACGCC GTGTCGGAGC TCCGCGACGC GTGCACCACC ATCATCTGGA
TCGCGTCGGC GCTGCACGCG GCGGTCAACT TCGGCCAGTA CCCGTACGCC GGTTACCTCC CGAACCGGCC GACGGTGAGC
CGGCGGCGGA TGCCGGAGCC CGGGACGGAG GCGTACGGCG AGCTGGGGCG CGACCCGGAG CGGGCCTTCA TCCGCACCAT
CACCAGCCAG CTCCAGACCA TCATCGGCAT CTCGCTGATC GAGGTCCTGT CCAAGCACTC CTCCGACGAG GTGTACCTCG
GGCAGCGCGA CACGCCGGCG TGGACGTCGG ACGCCAGGGC GCTGGAGGCG TTCCGGCGGT TCAGCGACCG GCTGGTGGAG
ATCGAAGGGA AGGTGGTGGG CATGAACGGC GACGCGGGGC TCAAGAACCG CAATGGCCCA GCCGAGTTCC CATACATGCT
GCTTTACCCC AACACCTCCG ACGTCACCGG CGCCGCCGCC GGCATCACCG CCAAGGGCAT CCCCAACAGC ATCTCGATCT
GA