Os03t0701800-01

Locus

Os03g0701800

Description

Phosphatidylinositol 4-phosphate 5-kinase, Regulation of heading, Regulation of floral induction genes

RAP-DB Gene Symbol Synonym(s)

OsPIPK1

RAP-DB Gene Name Synonym(s)

rice phosphatidylinositol monophosphate kinase 1, phosphatidylinositol 4-phosphate 5-kinase 1

CGSNL Gene Symbol

PIPK1

CGSNL Gene Name

PHOSPHATIDYLINOSITOL MONOPHOSPHATE KINASE 1

Oryzabase Gene Symbol Synonym(s)

OsPIPK1, PIP5K

Oryzabase Gene Name Synonym(s)

rice phosphatidylinositol monophosphate kinase1, Phosphatidylinositol-4-phosphate 5-kinase 1, 1-phosphatidylinositol-4-phosphate kinase, PtdIns(4)P-5-kinase, Diphosphoinositide kinase

Transcript Evidence

AJ544688

AK065869 (truncated)

Protein Evidence

Q6EX42-2

Literature

PMID: 15159629

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

September 13, 2017

Gene Ontology (GO)

Biological Process: phosphatidylinositol metabolic process (GO:0046488)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: phosphatidylinositol phosphate kinase activity (GO:0016307)

Molecular Function: 1-phosphatidylinositol-4-phosphate 5-kinase activity (GO:0016308)

Functional domain (InterPro)

Phosphatidylinositol-4-phosphate 5-kinase, N-terminal (IPR027484)

Phosphatidylinositol-4-phosphate 5-kinase, C-terminal (IPR027483)

Phosphatidylinositol-4-phosphate 5-kinase, plant (IPR017163)

Phosphatidylinositol-4-phosphate 5-kinase, core (IPR002498)

MORN motif (IPR003409)

Full-length cDNA

J013045E16(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os03t0701800-01)

RiceXPro (AK065869)

Others

Oryzabase (6257)

KEGG (Os03t0701800-01 (EC:2.7.1.68))

Transcript

2412 bp

>Os03t0701800-01 Phosphatidylinositol 4-phosphate 5-kinase, Regulation of heading, Regulation of floral induction genes
ATGCCGGGGCTCCACGTGGTCTCCTTCCTCGTTGTGCTACTGCTGCAGCTGAGATCTTCT
GGAATGCATCTTGTGGCTTCTGAGCTATTCTGGGGTAATACCCTTCCAAATGGGGACATC
TACGTGGGGAGCTTCGATGGGTTAGTCCCTCATGGACCGGGAAAGTATATGTGGACAGAT
GGAGCTCTTTATGATGGTGAGTGGGACAAGAGTAAAATGACCGGGAGAGGACTAATTCAG
TGGCCTTCTGGTGCATCCTATGAAGGTGACTTCCGTGGAGGTTTCATTGATGGAGCAGGC
ACTTTCAAGGGAGTTGATGGCTCAGTTTACAAAGGTTCTTGGAGGATGAACAAGAAGCAT
GGTATGGGGACAATGGTTTACTCTAACTCCGACACTTATGAAGGTTTCTGGAATGAAGGT
TTACCTGATGAATTTGGTAAATACACATGGGCTGATGGCAACGTATACATTGGAAGATGG
AAATCAGGCAAAATGAATGGCAGCGGGGTAATGCAGTGGATAAATGGTGATACTCTTGAC
TGTAATTGGCTCAATGGCCTGGCTCATGGCAAAGGTTACTGCAAATATGCATCTGGGGCT
TGCTACATTGGTACATGGGATAGAGGACTAAAGGATGGCCATGGTACATTTTATCAACCT
GGAAGCAAAATTCCTTGTAACCTTGAAGTTTCTGACTGTCTAACAAGTCATGATGGTACA
AGTGCTTCAAGTTCTAGTAATGAAAAGATCACTATTGGACTGTTATTTCTATTGCAAAAA
CTGTGCAAGAATTGGAGGTTGCGTAGGTTTCTTCATCGGCCCAGACGTATTTCAAATGGT
ACCACACCAGTTTTCGATGATAATTCTGGAAGCCATCTATGCCAAGATGTATCAAGTAAA
TCATTTTCAGCTGATGATCAGTGTCTACAAGACAGTGAAGTTGATAAAGATTCGGTTTAT
GAACGGGAATACGTACAAGGAGTGCTTATCATGGAACAACCAAAAAACGAAGATTCAAGA
ATGTCGGAGAGCGGTATAGCACAAGAAAATAACTGGGAGAAACAAGCTAAAGGACCAATG
GAGACTATTTACAAGGGCCATAGGAGCTATTATCTAATGCTTAACTTGCAACTTGGCATC
AGGTATACTGTAGGTAAAATTACCCCTGTGCCTTTGCGTGAAGTTCGTTCAAATGATTTT
GGACCTCGAGCACGAATAAAAATGTACTTCCCTTGTGAGGGATCCCAGTATACCCCTCCG
CACTACTCTGTCGATTTCTTTTGGAAAGACTATTGTCCGATGGTCTTCCGGAATCTTCGA
GAAATGTTTCATATCGATGCTGCAGATTAcatgatgtctatatgtggtggtgatagtcta
aaggagctttcttcacctgggaaaagtggcagcattttctatctttctcaagatgaacgt
tttgttataaaaACATTGAGGAAAACTGAGCTGAAGATACTATTGAAGATGCTTCCAAAG
TATTACAATCATGTCAAAGCTTATGATAATACGCTCATTACAAAATTCTTTGGCGTGCAC
AGGATTACTCTGAAACCTGGAAGAAAGGTCCGTTTTGTTGTCATGGGAAATATGTTTTGT
ACTGAACTGCGAATTCATCGTAAGTATGACTTAAAGGGCTCTACACAAGGCCGATCAACA
AAGAAGCAAAATATAAATGAGAACACAACACTAAAGGACCTTGACCTATCATATGTTTTT
CACGTGGATAAACCATGGAGGGAGGCACTTTTCAGGCAGATAGCTCTTGATTGTATGTTC
CTGGAATCCCAATCTATAATTGACTATAGCATGCTATTGGGAATCCATTTCCGAGCTCCC
AATCACCTGAAGCGTATCACATCATGTCAGAACGCTCTTGAAAGTACTGGAATTTCAGCT
GAAACGGAATGTAGTGTTGCACTGCATCATGAGGAGACAATTTCTTCAAAGGGATTTCTA
CTAGTTGCTGCTGATGAGCCAGGTCCAGCAGTACGTGGTTCGCACATAAGAGGAAGCATG
GTTAGGGCAGCAGAAGGTGGTTATGAAGAAGTTGATCTTGTTTTGCCAGGCACTGGAAGG
TTCCGTGTTCAGCTAGGGGTGAATATGCCAGCTCGAGCTCGGAAAGTGCAAGAGGACGTG
AACGTAGAAGTAGAAAACAGGGACACCATTGAAGAGTATGATGTTGTCCTATACCTTGGT
ATCATCGACATACTACAAGAGTATAATGTGTCCAAAAGAGTTGAGCATGCTGTCAAATCA
CTAAAATTCGACCCTCTTTCGATATCAGCTGTTGATCCAAATTTGTATTCGAGACGATTT
ATAAGTTTCTTGGAGAAGGTTTTCCCCGAGCAAGATTGAACAGTAAATAGATATTGCAAG
TTTCTTGGAGAA

CDS

2379 bp

>Os03t0701800-01 Phosphatidylinositol 4-phosphate 5-kinase, Regulation of heading, Regulation of floral induction genes
ATGCCGGGGCTCCACGTGGTCTCCTTCCTCGTTGTGCTACTGCTGCAGCTGAGATCTTCT
GGAATGCATCTTGTGGCTTCTGAGCTATTCTGGGGTAATACCCTTCCAAATGGGGACATC
TACGTGGGGAGCTTCGATGGGTTAGTCCCTCATGGACCGGGAAAGTATATGTGGACAGAT
GGAGCTCTTTATGATGGTGAGTGGGACAAGAGTAAAATGACCGGGAGAGGACTAATTCAG
TGGCCTTCTGGTGCATCCTATGAAGGTGACTTCCGTGGAGGTTTCATTGATGGAGCAGGC
ACTTTCAAGGGAGTTGATGGCTCAGTTTACAAAGGTTCTTGGAGGATGAACAAGAAGCAT
GGTATGGGGACAATGGTTTACTCTAACTCCGACACTTATGAAGGTTTCTGGAATGAAGGT
TTACCTGATGAATTTGGTAAATACACATGGGCTGATGGCAACGTATACATTGGAAGATGG
AAATCAGGCAAAATGAATGGCAGCGGGGTAATGCAGTGGATAAATGGTGATACTCTTGAC
TGTAATTGGCTCAATGGCCTGGCTCATGGCAAAGGTTACTGCAAATATGCATCTGGGGCT
TGCTACATTGGTACATGGGATAGAGGACTAAAGGATGGCCATGGTACATTTTATCAACCT
GGAAGCAAAATTCCTTGTAACCTTGAAGTTTCTGACTGTCTAACAAGTCATGATGGTACA
AGTGCTTCAAGTTCTAGTAATGAAAAGATCACTATTGGACTGTTATTTCTATTGCAAAAA
CTGTGCAAGAATTGGAGGTTGCGTAGGTTTCTTCATCGGCCCAGACGTATTTCAAATGGT
ACCACACCAGTTTTCGATGATAATTCTGGAAGCCATCTATGCCAAGATGTATCAAGTAAA
TCATTTTCAGCTGATGATCAGTGTCTACAAGACAGTGAAGTTGATAAAGATTCGGTTTAT
GAACGGGAATACGTACAAGGAGTGCTTATCATGGAACAACCAAAAAACGAAGATTCAAGA
ATGTCGGAGAGCGGTATAGCACAAGAAAATAACTGGGAGAAACAAGCTAAAGGACCAATG
GAGACTATTTACAAGGGCCATAGGAGCTATTATCTAATGCTTAACTTGCAACTTGGCATC
AGGTATACTGTAGGTAAAATTACCCCTGTGCCTTTGCGTGAAGTTCGTTCAAATGATTTT
GGACCTCGAGCACGAATAAAAATGTACTTCCCTTGTGAGGGATCCCAGTATACCCCTCCG
CACTACTCTGTCGATTTCTTTTGGAAAGACTATTGTCCGATGGTCTTCCGGAATCTTCGA
GAAATGTTTCATATCGATGCTGCAGATTAcatgatgtctatatgtggtggtgatagtcta
aaggagctttcttcacctgggaaaagtggcagcattttctatctttctcaagatgaacgt
tttgttataaaaACATTGAGGAAAACTGAGCTGAAGATACTATTGAAGATGCTTCCAAAG
TATTACAATCATGTCAAAGCTTATGATAATACGCTCATTACAAAATTCTTTGGCGTGCAC
AGGATTACTCTGAAACCTGGAAGAAAGGTCCGTTTTGTTGTCATGGGAAATATGTTTTGT
ACTGAACTGCGAATTCATCGTAAGTATGACTTAAAGGGCTCTACACAAGGCCGATCAACA
AAGAAGCAAAATATAAATGAGAACACAACACTAAAGGACCTTGACCTATCATATGTTTTT
CACGTGGATAAACCATGGAGGGAGGCACTTTTCAGGCAGATAGCTCTTGATTGTATGTTC
CTGGAATCCCAATCTATAATTGACTATAGCATGCTATTGGGAATCCATTTCCGAGCTCCC
AATCACCTGAAGCGTATCACATCATGTCAGAACGCTCTTGAAAGTACTGGAATTTCAGCT
GAAACGGAATGTAGTGTTGCACTGCATCATGAGGAGACAATTTCTTCAAAGGGATTTCTA
CTAGTTGCTGCTGATGAGCCAGGTCCAGCAGTACGTGGTTCGCACATAAGAGGAAGCATG
GTTAGGGCAGCAGAAGGTGGTTATGAAGAAGTTGATCTTGTTTTGCCAGGCACTGGAAGG
TTCCGTGTTCAGCTAGGGGTGAATATGCCAGCTCGAGCTCGGAAAGTGCAAGAGGACGTG
AACGTAGAAGTAGAAAACAGGGACACCATTGAAGAGTATGATGTTGTCCTATACCTTGGT
ATCATCGACATACTACAAGAGTATAATGTGTCCAAAAGAGTTGAGCATGCTGTCAAATCA
CTAAAATTCGACCCTCTTTCGATATCAGCTGTTGATCCAAATTTGTATTCGAGACGATTT
ATAAGTTTCTTGGAGAAGGTTTTCCCCGAGCAAGATTGA

Protein

792 aa

>Os03t0701800-01 Phosphatidylinositol 4-phosphate 5-kinase, Regulation of heading, Regulation of floral induction genes
MPGLHVVSFLVVLLLQLRSSGMHLVASELFWGNTLPNGDIYVGSFDGLVPHGPGKYMWTD
GALYDGEWDKSKMTGRGLIQWPSGASYEGDFRGGFIDGAGTFKGVDGSVYKGSWRMNKKH
GMGTMVYSNSDTYEGFWNEGLPDEFGKYTWADGNVYIGRWKSGKMNGSGVMQWINGDTLD
CNWLNGLAHGKGYCKYASGACYIGTWDRGLKDGHGTFYQPGSKIPCNLEVSDCLTSHDGT
SASSSSNEKITIGLLFLLQKLCKNWRLRRFLHRPRRISNGTTPVFDDNSGSHLCQDVSSK
SFSADDQCLQDSEVDKDSVYEREYVQGVLIMEQPKNEDSRMSESGIAQENNWEKQAKGPM
ETIYKGHRSYYLMLNLQLGIRYTVGKITPVPLREVRSNDFGPRARIKMYFPCEGSQYTPP
HYSVDFFWKDYCPMVFRNLREMFHIDAADYMMSICGGDSLKELSSPGKSGSIFYLSQDER
FVIKTLRKTELKILLKMLPKYYNHVKAYDNTLITKFFGVHRITLKPGRKVRFVVMGNMFC
TELRIHRKYDLKGSTQGRSTKKQNINENTTLKDLDLSYVFHVDKPWREALFRQIALDCMF
LESQSIIDYSMLLGIHFRAPNHLKRITSCQNALESTGISAETECSVALHHEETISSKGFL
LVAADEPGPAVRGSHIRGSMVRAAEGGYEEVDLVLPGTGRFRVQLGVNMPARARKVQEDV
NVEVENRDTIEEYDVVLYLGIIDILQEYNVSKRVEHAVKSLKFDPLSISAVDPNLYSRRF
ISFLEKVFPEQD*

CDS

chr03:28180227..28180279 (+ strand) : 53 bp

chr03:28180669..28180707 (+ strand) : 39 bp

chr03:28181010..28182059 (+ strand) : 1050 bp

chr03:28182631..28182798 (+ strand) : 168 bp

chr03:28183133..28183298 (+ strand) : 166 bp

chr03:28183475..28183585 (+ strand) : 111 bp

chr03:28183673..28183860 (+ strand) : 188 bp

chr03:28184378..28184532 (+ strand) : 155 bp

chr03:28184727..28184895 (+ strand) : 169 bp

chr03:28185640..28185919 (+ strand) : 280 bp

3'UTR

chr03:28185920..28185952 (+ strand) : 33 bp

FASTA

>Os03t0701800-01 class=Sequence position=chr03:28180227..28185952 (+ strand)
ATGCCGGGGC TCCACGTGGT CTCCTTCCTC GTTGTGCTAC TGCTGCAGCT GAGGTACGTT CTTGCTTGCT TGGATTGGCG
CGGTGATCTG GAAGGCCGCT TGCGCTGTAA CCAGGAGTCG TTCTGGGTAG CTTGATCTGT CTTGTTGATG CGAGCTCGAG
ATGATGCTCT TCTGGGAGCA GCGTTTATCC GGTTTGCTTG AACAGTACAA GAGGATATTT AGTTTTCTCT ATTTGCTTTT
TGTCACTTTG AGCTGGGCTA GTGTGATTGC AAAGTTTGCA ACTGCTTTCA GTTGTACGTG GTAACGGAAA TCTGCTTTGC
TGAAGGCATT AGAGTTGTTA TGTCTGCGAT GTATTTCGAT GTATCTGGGA GATTAAACCT GTTTTCGGTC AGAATTGGTT
ATGCTCGAAT ACTGGATCAT AGTTTTTGCT GCCTTGTTTC AGATCTTCTG GAATGCATCT TGTGGCTTCT GAGCTATTCT
GGTAAAATCT TGACATGGCC CGAGCAGAGA CAAGCAAGGG GAGCATCCAG AGGTGTGATA ATTCTCGTGT CTATCTCTGC
GTATTCTTCA TTTTTTTTTC TTGGTAGGAA TTACAAGTGC TTCATCGTGT TCTTCCCACA TATTGAAAAG CACATTAAAA
TCAGCGCAAA GTTTGCAATC ATCCACTGCC CCCACTCTCC AGCTGTCCAG CACTAATTGC GTTGCTTTAC GATTGGGCAA
TTTAGTTTTG CAAGCACCAC ACAATGTAAT TTGAATCTCA TATATATTTT TTATTCTGGC TAGGGGTAAT ACCCTTCCAA
ATGGGGACAT CTACGTGGGG AGCTTCGATG GGTTAGTCCC TCATGGACCG GGAAAGTATA TGTGGACAGA TGGAGCTCTT
TATGATGGTG AGTGGGACAA GAGTAAAATG ACCGGGAGAG GACTAATTCA GTGGCCTTCT GGTGCATCCT ATGAAGGTGA
CTTCCGTGGA GGTTTCATTG ATGGAGCAGG CACTTTCAAG GGAGTTGATG GCTCAGTTTA CAAAGGTTCT TGGAGGATGA
ACAAGAAGCA TGGTATGGGG ACAATGGTTT ACTCTAACTC CGACACTTAT GAAGGTTTCT GGAATGAAGG TTTACCTGAT
GAATTTGGTA AATACACATG GGCTGATGGC AACGTATACA TTGGAAGATG GAAATCAGGC AAAATGAATG GCAGCGGGGT
AATGCAGTGG ATAAATGGTG ATACTCTTGA CTGTAATTGG CTCAATGGCC TGGCTCATGG CAAAGGTTAC TGCAAATATG
CATCTGGGGC TTGCTACATT GGTACATGGG ATAGAGGACT AAAGGATGGC CATGGTACAT TTTATCAACC TGGAAGCAAA
ATTCCTTGTA ACCTTGAAGT TTCTGACTGT CTAACAAGTC ATGATGGTAC AAGTGCTTCA AGTTCTAGTA ATGAAAAGAT
CACTATTGGA CTGTTATTTC TATTGCAAAA ACTGTGCAAG AATTGGAGGT TGCGTAGGTT TCTTCATCGG CCCAGACGTA
TTTCAAATGG TACCACACCA GTTTTCGATG ATAATTCTGG AAGCCATCTA TGCCAAGATG TATCAAGTAA ATCATTTTCA
GCTGATGATC AGTGTCTACA AGACAGTGAA GTTGATAAAG ATTCGGTTTA TGAACGGGAA TACGTACAAG GAGTGCTTAT
CATGGAACAA CCAAAAAACG AAGATTCAAG AATGTCGGAG AGCGGTATAG CACAAGAAAA TAACTGGGAG AAACAAGCTA
AAGGACCAAT GGAGACTATT TACAAGGGCC ATAGGAGCTA TTATCTAATG CTTAACTTGC AACTTGGCAT CAGGTAAGCT
TCATTGTATG AATGCATCAT TGTTTGCTAT ACAAGCTTTG GAGGGTTACA CTCAGTGCTT ATTATATTTT CTGGTTTGTT
CTGGATATAT CCATTTAGGA CAAGGGCACC TTCCATTTAG ATCGATACAT ACGTGTAAAG CAAACTCTTT TTTGACAATT
CAAGCATAAA TTAGTGACTG AAGAATCAAT AATCATTTCA GTGGGGAAAA ATTAACCACC AGTTAGAATG TTCTCACTAT
GAGTGACAAC AAAAGTAGTT TCTTCTTTCG GGAAAAAGTG CCTTCTCTTT TTGAAAAATG ACATAAGTAG TTGTATTTTG
ATATGGAGGG AGTATGTCAT AATGCATCTA GTCACGAGCC ATCTGTTAAT TTTTTACTAG CATGTTATTT GTCTTATCAT
AATAGTGATT GGATGGTATA ATAGCCATAT TTTATGAAAA ACATCGATTA CCTCATGAAA TATAATTTTT TTTATGTTAT
TTTTTATGTT TACCTCACGA CATGTAACTA GTTGATGTTC TTTTTAATGA TTACCCCATT TGACTATACA GTACTTCTAT
GCAGGTATAC TGTAGGTAAA ATTACCCCTG TGCCTTTGCG TGAAGTTCGT TCAAATGATT TTGGACCTCG AGCACGAATA
AAAATGTACT TCCCTTGTGA GGGATCCCAG TATACCCCTC CGCACTACTC TGTCGATTTC TTTTGGAAAG ACTATTGTCC
GATGGTCTTC CGGTATATCT CTTTCCAATC TTCTCATTGT GCGATAGTCT AGTACTTCAT ACTGTTCTTT TATTATATCA
TCTGATTGTA TTACATAGGT GGTTCACGCA TTCTGTACTG AACATGGGTG GTTGCTCCTC TGTGGTTCAC CCCTCCCTTG
TTAACTGTAG GAAATTGCAA CCATGATCTT ATGTATATAT ATGCTATCAC TATCATATTT TCAGATAACA CTGCAGGATG
ATACAGACAT TGTTTAGAAA TGCATCGACT TGAAAGTTCG ATCAATTCTG TCAATTGTTC TTGTAATTTT CTCCATATCT
TATTAGCTCA TAATTTACTC TACCAGGAAT CTTCGAGAAA TGTTTCATAT CGATGCTGCA GATTAcatga tgtctatatg
tggtggtgat agtctaaagg agctttcttc acctgggaaa agtggcagca ttttctatct ttctcaagat gaacgttttg
ttataaaaAC ATTGAGGAAA ACTGAGCTGA AGGTATGACC CACCCTCAAT TTTTTTCTTG CAATAACAAT AGTGTTATTT
GTTAATTAAA AATGACTAAA ACTGAGCTTT ACAAGAACAA CAAAGATTTG TGCTAAAAAC CGTGTATATC CTTGTTAAGT
GATAAGATAT GCCTACTGCA GATTGGTTTG ATGTAATACG TGCTGCAGAT ACTATTGAAG ATGCTTCCAA AGTATTACAA
TCATGTCAAA GCTTATGATA ATACGCTCAT TACAAAATTC TTTGGCGTGC ACAGGATTAC TCTGAAACCT GGAAGAAAGG
TACATTATCA TATCATACTG TTGTGTTGAA TGTTGTTGTC TATTTGTACA CATTTGCTAT ATTAATTCTA TGTATGGTGT
TAATAGGTCC GTTTTGTTGT CATGGGAAAT ATGTTTTGTA CTGAACTGCG AATTCATCGT AAGTATGACT TAAAGGGCTC
TACACAAGGC CGATCAACAA AGAAGCAAAA TATAAATGAG AACACAACAC TAAAGGACCT TGACCTATCA TATGTTTTTC
ACGTGGATAA ACCATGGAGG GAGGCACTTT TCAGGCAAAT TGCTACTTTC TTGCTCCTCT TTTTTCTGAA CATCTTACTG
TCGTCTTTCA TGGTTTTGTC TATATTGGCT TGAAGTCCAG GTTCCATAAC TTACCGTTTA TGATGTTACT TCTGGAGATT
GTGTTCACTG GGTAGTCCCT TCTGGAAAAT TAAAAAGAAC AGTAGATTTA AATGACTTGT GCAGATTCCT GCTTCAGTCC
CATGATTGGT GGACATCAAA ATTATTTTCT ACTATTTTGA TATTGATTCT TATCCTATTC TTGAGATCTG AAGAATACTT
AAGATGGACA ATTTTTATTT ATACTATAGC AATAAATAGA TTTTTTTAAA TATAAACAAC TAGATTAAAG AGGCAAACCA
GATTTTAAGC AGTGTCCGAC CATGCATACA AGAGATTGAA TTCCAGCTGT CTAGTTCAGT TTTGCATATT ACTGCTCCAT
TTCTGCTGTG CTATTTTTCT TAACATGGTT GACGATGATA TCTTGAGAGC CAACAGTTGT ACTATTTTCA GGCAGATAGC
TCTTGATTGT ATGTTCCTGG AATCCCAATC TATAATTGAC TATAGCATGC TATTGGGAAT CCATTTCCGA GCTCCCAATC
ACCTGAAGCG TATCACATCA TGTCAGAACG CTCTTGAAAG TACTGGAATT TCAGCTGAAA CGGAATGTAC GTACTAAACC
TTAAGTACAT CTGAGTTCTC TTTATTATAT TCCTCTGAAA ATTTGTCCTT TTACTAAATC TGAAGTCAGG ACTACACCAG
ATTCTTTATA TCATTACATC AACCAATTGC CTATCTTCAG CTTTTGACTT CCATTTGTTG CCTAATGGTA ATATCTTAGT
CTTTTTTTCA CCTTAATCAG GTAGTGTTGC ACTGCATCAT GAGGAGACAA TTTCTTCAAA GGGATTTCTA CTAGTTGCTG
CTGATGAGCC AGGTCCAGCA GTACGTGGTT CGCACATAAG AGGAAGCATG GTTAGGGCAG CAGAAGGTGG TTATGAAGAA
GTTGATCTTG TTTTGCCAGG CACTGGAAGG TAGATTGACT TGTACTTAAT TATTTCAAAG TTCAACTTAG CATTGGGTAT
ATTTGTTGCT GCACAATCTG AACATGCATA GAAGAAAGAA TATAAATTGC GTAGTATAGC TATCACACTC TTCAGGAAAG
ATTTCTTAGT ATATCAGTGT GTTCTAAAGT ACAAAGTACA ACGAACTTGT TGGTGACTTG ATCCATTATT TGATTTTTTG
AACTTTTATA TCAACCCTTT AGCTTTAAAA TAAACATTCA CAATACAACT CAACGTTGGG TGAACCATGG CAGCTCCACC
AGACAACACG ATAATTTTAT GACTATTCAA TGCAACATCT ACGTTTGCAA GTTGATAGTT AAGTGTGAAT TCTCGAAGCA
TTCATAGATG TAGAGCATAT AATAGCTCGT GCATTTGAAT AGGCTGTGTC AAAAGAATTA TCATTTTTGT GCATGGTAAA
ACAAGGTCAA GTGTGTGTTC ATATATTTGG AAAGAAATAT CAGTAATATA CATTGCCTGT CTTCTTTAGT GCACATACGG
CGGTGGTTTT ACACTTTTTT GCACCTGTGC CCCTGCTATA CTAACTTAAA CTTACCGTTG GTGCAGTTGC ATATCATAAG
TGCAGAAAAT CCCAACCACA TATTCACACG TTTTACATGC CGTCAATGTT TTTTTCTGAA ACTATGGTCT GCGTGGTACT
TTGTTTTCAC AAAGATGCAT TCTGTTTCTG ACTCATTTGT TCGTTATTTT CAGGTTCCGT GTTCAGCTAG GGGTGAATAT
GCCAGCTCGA GCTCGGAAAG TGCAAGAGGA CGTGAACGTA GAAGTAGAAA ACAGGGACAC CATTGAAGAG TATGATGTTG
TCCTATACCT TGGTATCATC GACATACTAC AAGAGTATAA TGTGTCCAAA AGAGTTGAGC ATGCTGTCAA ATCACTAAAA
TTCGACCCTC TTTCGATATC AGCTGTTGAT CCAAATTTGT ATTCGAGACG ATTTATAAGT TTCTTGGAGA AGGTTTTCCC
CGAGCAAGAT TGAACAGTAA ATAGATATTG CAAGTTTCTT GGAGAA

Locus: Os03g0701800

Loading...

Locus: Os03g0701800

Loading...