Os03t0701800-02

Locus

Os03g0701800

Description

Similar to Isoform 2 of Phosphatidylinositol-4-phosphate 5-kinase 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PIPK1

CGSNL Gene Name

PHOSPHATIDYLINOSITOL MONOPHOSPHATE KINASE 1

Oryzabase Gene Symbol Synonym(s)

OsPIPK1, PIP5K

Oryzabase Gene Name Synonym(s)

rice phosphatidylinositol monophosphate kinase1, Phosphatidylinositol-4-phosphate 5-kinase 1, 1-phosphatidylinositol-4-phosphate kinase, PtdIns(4)P-5-kinase, Diphosphoinositide kinase

Transcript Evidence

AK099707 (DDBJ, Best hit)

Protein Evidence

Q6EX42-2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: phosphatidylinositol metabolic process (GO:0046488)

Molecular Function: phosphatidylinositol phosphate kinase activity (GO:0016307)

Functional domain (InterPro)

Phosphatidylinositol-4-phosphate 5-kinase, core (IPR002498)

Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup (IPR016034)

Phosphatidylinositol-4-phosphate 5-kinase (IPR023610)

Full-length cDNA

J013075K17 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0701800-02)

RiceXPro (AK099707)

Others

Oryzabase (6257)

KEGG (Os03t0701800-02 (EC:2.7.1.68))

Transcript

1623 bp

>Os03t0701800-02 Similar to Isoform 2 of Phosphatidylinositol-4-phosphate 5-kinase 1.
CATATCGATGCTGCAGATTAcatgatgtctatatgtggtggtgatagtctaaaggagctt
tcttcacctgggaaaagtggcagcattttctatctttctcaagatgaacgttttgttata
aaaACATTGAGGAAAACTGAGCTGAAGATTGGTTTGATGTAATACGTGCTGCAGATACTA
TTGAAGATGCTTCCAAAGTATTACAATCATGTCAAAGCTTATGATAATACGCTCATTACA
AAATTCTTTGGCGTGCACAGGATTACTCTGAAACCTGGAAGAAAGGTCCGTTTTGTTGTC
ATGGGAAATATGTTTTGTACTGAACTGCGAATTCATCGTAAGTATGACTTAAAGGGCTCT
ACACAAGGCCGATCAACAAAGAAGCAAAATATAAATGAGAACACAACACTAAAGGACCTT
GACCTATCATATGTTTTTCACGTGGATAAACCATGGAGGGAGGCACTTTTCAGGCAAATT
GCTACTTTCTTGCTCCTCTTTTTTCTGAACATCTTACTGTCGTCTTTCATGGTTTTGTCT
ATATTGGCTTGAAGTCCAGGTTCCATAACTTACCGTTTATGATGTTACTTCTGGAGATTG
TGTTCACTGGGTAGTCCCTTCTGGAAAATTAAAAAGAACAGTAGATTTAAATGACTTGTG
CAGATTCCTGCTTCAGTCCCATGATTGGTGGACATCAAAATTATTTTCTACTATTTTGAT
ATTGATTCTTATCCTATTCTTGAGATCTGAAGAATACTTAAGATGGACAATTTTTATTTA
TACTATAGCAATAAATAGATTTTTTTAAATATAAACAACTAGATTAAAGAGGCAAACCAG
ATTTTAAGCAGTGTCCGACCATGCATACAAGAGATTGAATTCCAGCTGTCTAGTTCAGTT
TTGCATATTACTGCTCCATTTCTGCTGTGCTATTTTTCTTAACATGGTTGACGATGATAT
CTTGAGAGCCAACAGTTGTACTATTTTCAGGCAGATAGCTCTTGATTGTATGTTCCTGGA
ATCCCAATCTATAATTGACTATAGCATGCTATTGGGAATCCATTTCCGAGCTCCCAATCA
CCTGAAGCGTATCACATCATGTCAGAACGCTCTTGAAAGTACTGGAATTTCAGCTGAAAC
GGAATGTAGTGTTGCACTGCATCATGAGGAGACAATTTCTTCAAAGGGATTTCTACTAGT
TGCTGCTGATGAGCCAGGTCCAGCAGTACGTGGTTCGCACATAAGAGGAAGCATGGTTAG
GGCAGCAGAAGGTGGTTATGAAGAAGTTGATCTTGTTTTGCCAGGCACTGGAAGGTTCCG
TGTTCAGCTAGGGGTGAATATGCCAGCTCGAGCTCGGAAAGTGCAAGAGGACGTGAACGT
AGAAGTAGAAAACAGGGACACCATTGAAGAGTATGATGTTGTCCTATACCTTGGTATCAT
CGACATACTACAAGAGTATAATGTGTCCAAAAGAGTTGAGCATGCTGTCAAATCACTAAA
ATTCGACCCTCTTTCGATATCAGCTGTTGATCCAAATTTGTATTCGAGACGATTTATAAG
TTTCTTGGAGAAGGTTTTCCCCGAGCAAGATTGAACAGTAAATAGATATTGCAAGTTTCT
TGG

CDS

390 bp

>Os03t0701800-02 Similar to Isoform 2 of Phosphatidylinositol-4-phosphate 5-kinase 1.
TACGTGCTGCAGATACTATTGAAGATGCTTCCAAAGTATTACAATCATGTCAAAGCTTAT
GATAATACGCTCATTACAAAATTCTTTGGCGTGCACAGGATTACTCTGAAACCTGGAAGA
AAGGTCCGTTTTGTTGTCATGGGAAATATGTTTTGTACTGAACTGCGAATTCATCGTAAG
TATGACTTAAAGGGCTCTACACAAGGCCGATCAACAAAGAAGCAAAATATAAATGAGAAC
ACAACACTAAAGGACCTTGACCTATCATATGTTTTTCACGTGGATAAACCATGGAGGGAG
GCACTTTTCAGGCAAATTGCTACTTTCTTGCTCCTCTTTTTTCTGAACATCTTACTGTCG
TCTTTCATGGTTTTGTCTATATTGGCTTGA

Protein

129 aa

>Os03t0701800-02 Similar to Isoform 2 of Phosphatidylinositol-4-phosphate 5-kinase 1.
YVLQILLKMLPKYYNHVKAYDNTLITKFFGVHRITLKPGRKVRFVVMGNMFCTELRIHRK
YDLKGSTQGRSTKKQNINENTTLKDLDLSYVFHVDKPWREALFRQIATFLLLFFLNILLS
SFMVLSILA*

5'UTR

chr03:28183152..28183298 (+ strand) : 147 bp

chr03:28183448..28183462 (+ strand) : 15 bp

CDS

chr03:28183463..28183585 (+ strand) : 123 bp

chr03:28183673..28183939 (+ strand) : 267 bp

3'UTR

chr03:28183940..28184532 (+ strand) : 593 bp

chr03:28184727..28184895 (+ strand) : 169 bp

chr03:28185640..28185948 (+ strand) : 309 bp

FASTA

>Os03t0701800-02 class=Sequence position=chr03:28183152..28185948 (+ strand)
CATATCGATG CTGCAGATTA catgatgtct atatgtggtg gtgatagtct aaaggagctt tcttcacctg ggaaaagtgg
cagcattttc tatctttctc aagatgaacg ttttgttata aaaACATTGA GGAAAACTGA GCTGAAGGTA TGACCCACCC
TCAATTTTTT TCTTGCAATA ACAATAGTGT TATTTGTTAA TTAAAAATGA CTAAAACTGA GCTTTACAAG AACAACAAAG
ATTTGTGCTA AAAACCGTGT ATATCCTTGT TAAGTGATAA GATATGCCTA CTGCAGATTG GTTTGATGTA ATACGTGCTG
CAGATACTAT TGAAGATGCT TCCAAAGTAT TACAATCATG TCAAAGCTTA TGATAATACG CTCATTACAA AATTCTTTGG
CGTGCACAGG ATTACTCTGA AACCTGGAAG AAAGGTACAT TATCATATCA TACTGTTGTG TTGAATGTTG TTGTCTATTT
GTACACATTT GCTATATTAA TTCTATGTAT GGTGTTAATA GGTCCGTTTT GTTGTCATGG GAAATATGTT TTGTACTGAA
CTGCGAATTC ATCGTAAGTA TGACTTAAAG GGCTCTACAC AAGGCCGATC AACAAAGAAG CAAAATATAA ATGAGAACAC
AACACTAAAG GACCTTGACC TATCATATGT TTTTCACGTG GATAAACCAT GGAGGGAGGC ACTTTTCAGG CAAATTGCTA
CTTTCTTGCT CCTCTTTTTT CTGAACATCT TACTGTCGTC TTTCATGGTT TTGTCTATAT TGGCTTGAAG TCCAGGTTCC
ATAACTTACC GTTTATGATG TTACTTCTGG AGATTGTGTT CACTGGGTAG TCCCTTCTGG AAAATTAAAA AGAACAGTAG
ATTTAAATGA CTTGTGCAGA TTCCTGCTTC AGTCCCATGA TTGGTGGACA TCAAAATTAT TTTCTACTAT TTTGATATTG
ATTCTTATCC TATTCTTGAG ATCTGAAGAA TACTTAAGAT GGACAATTTT TATTTATACT ATAGCAATAA ATAGATTTTT
TTAAATATAA ACAACTAGAT TAAAGAGGCA AACCAGATTT TAAGCAGTGT CCGACCATGC ATACAAGAGA TTGAATTCCA
GCTGTCTAGT TCAGTTTTGC ATATTACTGC TCCATTTCTG CTGTGCTATT TTTCTTAACA TGGTTGACGA TGATATCTTG
AGAGCCAACA GTTGTACTAT TTTCAGGCAG ATAGCTCTTG ATTGTATGTT CCTGGAATCC CAATCTATAA TTGACTATAG
CATGCTATTG GGAATCCATT TCCGAGCTCC CAATCACCTG AAGCGTATCA CATCATGTCA GAACGCTCTT GAAAGTACTG
GAATTTCAGC TGAAACGGAA TGTACGTACT AAACCTTAAG TACATCTGAG TTCTCTTTAT TATATTCCTC TGAAAATTTG
TCCTTTTACT AAATCTGAAG TCAGGACTAC ACCAGATTCT TTATATCATT ACATCAACCA ATTGCCTATC TTCAGCTTTT
GACTTCCATT TGTTGCCTAA TGGTAATATC TTAGTCTTTT TTTCACCTTA ATCAGGTAGT GTTGCACTGC ATCATGAGGA
GACAATTTCT TCAAAGGGAT TTCTACTAGT TGCTGCTGAT GAGCCAGGTC CAGCAGTACG TGGTTCGCAC ATAAGAGGAA
GCATGGTTAG GGCAGCAGAA GGTGGTTATG AAGAAGTTGA TCTTGTTTTG CCAGGCACTG GAAGGTAGAT TGACTTGTAC
TTAATTATTT CAAAGTTCAA CTTAGCATTG GGTATATTTG TTGCTGCACA ATCTGAACAT GCATAGAAGA AAGAATATAA
ATTGCGTAGT ATAGCTATCA CACTCTTCAG GAAAGATTTC TTAGTATATC AGTGTGTTCT AAAGTACAAA GTACAACGAA
CTTGTTGGTG ACTTGATCCA TTATTTGATT TTTTGAACTT TTATATCAAC CCTTTAGCTT TAAAATAAAC ATTCACAATA
CAACTCAACG TTGGGTGAAC CATGGCAGCT CCACCAGACA ACACGATAAT TTTATGACTA TTCAATGCAA CATCTACGTT
TGCAAGTTGA TAGTTAAGTG TGAATTCTCG AAGCATTCAT AGATGTAGAG CATATAATAG CTCGTGCATT TGAATAGGCT
GTGTCAAAAG AATTATCATT TTTGTGCATG GTAAAACAAG GTCAAGTGTG TGTTCATATA TTTGGAAAGA AATATCAGTA
ATATACATTG CCTGTCTTCT TTAGTGCACA TACGGCGGTG GTTTTACACT TTTTTGCACC TGTGCCCCTG CTATACTAAC
TTAAACTTAC CGTTGGTGCA GTTGCATATC ATAAGTGCAG AAAATCCCAA CCACATATTC ACACGTTTTA CATGCCGTCA
ATGTTTTTTT CTGAAACTAT GGTCTGCGTG GTACTTTGTT TTCACAAAGA TGCATTCTGT TTCTGACTCA TTTGTTCGTT
ATTTTCAGGT TCCGTGTTCA GCTAGGGGTG AATATGCCAG CTCGAGCTCG GAAAGTGCAA GAGGACGTGA ACGTAGAAGT
AGAAAACAGG GACACCATTG AAGAGTATGA TGTTGTCCTA TACCTTGGTA TCATCGACAT ACTACAAGAG TATAATGTGT
CCAAAAGAGT TGAGCATGCT GTCAAATCAC TAAAATTCGA CCCTCTTTCG ATATCAGCTG TTGATCCAAA TTTGTATTCG
AGACGATTTA TAAGTTTCTT GGAGAAGGTT TTCCCCGAGC AAGATTGAAC AGTAAATAGA TATTGCAAGT TTCTTGG

Locus: Os03g0701800

Loading...

Locus: Os03g0701800

Loading...