Os03t0703200-01

Locus

Os03g0703200

Description

Similar to leucine-rich repeat family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSERL8, OsBAK1-6, SERL8, BAK1-6, TMS10L

Oryzabase Gene Name Synonym(s)

SERK-like gene 8, bri1-associated receptor kinase 1 (BAK1) homologue 6, TMS10-Like, Thermo-Sensitive Genic Male Sterile 10-like

Transcript Evidence

AK111846 (DDBJ, Best hit)

Protein Evidence

XP_002873449.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Leucine-rich repeat-containing N-terminal, type 2 (IPR013210)

Full-length cDNA

J023143O14 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0703200-01)

Others

Oryzabase (13031)

Transcript

2503 bp

>Os03t0703200-01 Similar to leucine-rich repeat family protein.
TGCGATCCGGAGGAGAAGGTCGCCGAATTCCGTCTTATCCAGAGATGGGGAGGTAAAAAG
GAGGGGGATCCACCTAACCAACCAAGTTGCGTCGCGCCTAAAAAAAATGGCCGCACGCGC
TCCGCCCCGGCAGCACCGGTCAATTCCTGCTGCTTCCTCGAGTCAACTGCTCCAGCGCAG
CGCCCCACCCACGCCTTTTACCCGCGCGCCAGCGGCGGCGGCGGCGGCGGCGGGGTGAGG
AGGTGAAGTGGGAGAGGCGGCGTGGACCTGCGACGACCTGCTTGCTGCCCAGCCTGCGAG
GGCAAGCCACTGGTGCCATACTGGACTGGCTTGCTTGTTAACTGGGTTAGCCAGGGACTC
CGGTATTATACTACTATGATCAGTTCGTGTACTTTTTTTCGCCGGGCAAGTTTCCCCAAG
GAACTCTTTTGATGCTGTAATTATAACTGAAGAGTCATGGATCTGCTCAGCGTCCTCCTA
ATTATAGCATCTCTGCTCCCATTTTCAGCATCTGACCGTCAAGGTGATGCACTATATGAT
ATGAAGCTGAAGCTGAATGCTACTGGTAACCAGCTTTCTGACTGGAACCAAAATCAAGTT
AACCCATGCACTTGGAATTCTGTTATTTGTGACAACAACTACAATGTTGTGCAAGTGTTT
TTTGTTTGTTCCAAGTTGGTGTGCCTGATGACAGATGCCCTCCTGCAGAACATTGGCATC
TATGGGATTCACTGGAGTTCTATCACCACGAATTGGAGAGCTTCAGTTTTTGAATGTTTT
GTCCTTGCCTGGTAATAAGATTACTGGTGGCATACCTGAGCAGATCGGCAACCTATCTAG
TTTGACAAGTTTGGATTTGGAAGACAATTTGTTGGTTGGACCAATACCGGCTTCTCTTGG
CCAGCTTTCAAAGCTCCAAATTCTGATACTAAGTCAAAACAATCTCAACGGAACTATACC
TGATACTGTAGCAAGAATCTCAAGCTTGACAGACATTAGGTTAGCCTACAATAAACTCTC
TGGTTCAATACCTGGTTCGCTGTTTCAAGTTGCACGTTACAACTTTTCTGGTAATAACTT
GACTTGTGGAGCAAACTTTCTGCATCCATGCTCATCAAGTATTTCTTATCAAGGTTCATC
CCATGGCTCAAAGGTAGGCATTGTACTCGGAACAGTTGTAGGAGCAATAGGGATACTTAT
AATAGGGGCTGTGTTTATTGTCTGTAATGGAAGGAGGAAAAGCCATCTACGAGAAGTTTT
TGTCGATGTATCAGGCGAGGACGATCGAAGAATTGCATTTGGTCAGTTGAAAAGATTTGC
CTGGCGAGAATTACAACTTGCAACCGATAGTTTCAGTGAGAAAAATGTCCTTGGACAGGG
GGGTTTCGGTAAAGTGTATAAAGGAGCACTTCCAGATGGCACTAAGATTGCTGTAAAGCG
GTTGACAGATTATGAAAGCCCTGGTGGGGAGGCTGCATTCTTGCGTGAAGTAGAGCTTAT
CAGTGTTGCAGTTCACCGGAATCTTTTAAGATTGATTGGCTTCTGTACAACACAAACAGA
ACGTCTACTTGTTTATCCTTTCATGCAGAATCTTAGTGTGGCCTATCGTTTACGAGAATT
CAAACCTGGCGAACCAATAttggattggtcagcaaggaaacgtgtggcaataggcacagc
acgtggactggagtacctgcacgagcactgtaatcccaagatcatacatcgagatgtcaa
ggctgccaacgtcctgcttgatgaggattttgagccagttgttggtgactttggcctggc
aaagttggttgatgtacagaagacatcagtgacaactcaagtccgtggaactatgggtca
cattgcgcctgaatatctgtccacagggaagtcatcggagagaactgatgtttttggtta
tggcataatgcttcttgagctggtcactggacaacgcgccatcgacttcTCACGGTTGGA
GGAAGAAGACGATGTGCTACTGCTTGACCATGTGAAGAAGCTGCAGAGGGAAGGGCAGCT
GGGCGCCATCGTGGACCGGAACCTGAGCAGCAACTACGACGGGCAGGAGGTGGAGATGAT
GATACAGATCGCGCTGCTGTGCACACAGGCGTCGCCGGAGGACCGGCCGTCCATGTCGGA
GGTGGTGCGGATGCTGGAAGGGGAAGGACTCGCGGAGCGGTGGGAGGAGTGGCAGCAGGT
GGAGGTGACGCGGCGGCAGGACTACGAGCGGATGCAGCAGCGCTTCGACTGGGGCGAGGA
CTCCATCTTCAACCAGGAAGCCATCGAGCTCTCCGCCGGCAGATGACGACTGCGTACGTC
CTGATGCATGTCACTTCCCAATCCCAGTGTTAATAGATATACATGTATGTATATGTATGG
TTGGCTCTTAGTTACCATAGGGTTGGTTATGTCACTAAAGAACCCATGTCAAGCCTCCAT
TTGTGTAGAGGAAAACAGCTAGAGACGCATGTGTTCAGAGTTC

CDS

339 bp

>Os03t0703200-01 Similar to leucine-rich repeat family protein.
ATGGATCTGCTCAGCGTCCTCCTAATTATAGCATCTCTGCTCCCATTTTCAGCATCTGAC
CGTCAAGGTGATGCACTATATGATATGAAGCTGAAGCTGAATGCTACTGGTAACCAGCTT
TCTGACTGGAACCAAAATCAAGTTAACCCATGCACTTGGAATTCTGTTATTTGTGACAAC
AACTACAATGTTGTGCAAGTGTTTTTTGTTTGTTCCAAGTTGGTGTGCCTGATGACAGAT
GCCCTCCTGCAGAACATTGGCATCTATGGGATTCACTGGAGTTCTATCACCACGAATTGG
AGAGCTTCAGTTTTTGAATGTTTTGTCCTTGCCTGGTAA

Protein

113 aa

>Os03t0703200-01 Similar to leucine-rich repeat family protein.
MDLLSVLLIIASLLPFSASDRQGDALYDMKLKLNATGNQLSDWNQNQVNPCTWNSVICDN
NYNVVQVFFVCSKLVCLMTDALLQNIGIYGIHWSSITTNWRASVFECFVLAW*

5'UTR

chr03:28259566..28259877 (- strand) : 312 bp

chr03:28258646..28258789 (- strand) : 144 bp

CDS

chr03:28258579..28258645 (- strand) : 67 bp

chr03:28258332..28258464 (- strand) : 133 bp

chr03:28257848..28257971 (- strand) : 124 bp

chr03:28257605..28257619 (- strand) : 15 bp

3'UTR

chr03:28257476..28257604 (- strand) : 129 bp

chr03:28257326..28257397 (- strand) : 72 bp

chr03:28257177..28257242 (- strand) : 66 bp

chr03:28257021..28257091 (- strand) : 71 bp

chr03:28256772..28256912 (- strand) : 141 bp

chr03:28255932..28256273 (- strand) : 342 bp

chr03:28255277..28255671 (- strand) : 395 bp

chr03:28254492..28254983 (- strand) : 492 bp

FASTA

>Os03t0703200-01 class=Sequence position=chr03:28254492..28259877 (- strand)
TGCGATCCGG AGGAGAAGGT CGCCGAATTC CGTCTTATCC AGAGATGGGG AGGTAAAAAG GAGGGGGATC CACCTAACCA
ACCAAGTTGC GTCGCGCCTA AAAAAAATGG CCGCACGCGC TCCGCCCCGG CAGCACCGGT CAATTCCTGC TGCTTCCTCG
AGTCAACTGC TCCAGCGCAG CGCCCCACCC ACGCCTTTTA CCCGCGCGCC AGCGGCGGCG GCGGCGGCGG CGGGGTGAGG
AGGTGAAGTG GGAGAGGCGG CGTGGACCTG CGACGACCTG CTTGCTGCCC AGCCTGCGAG GGCAAGCCAC TGGTAGGTAG
TACGTGCTTC TCTCTTCAGT CTTCACTGTC TGTGTGTGTG TGAATTGGAA TTTGGAAGTG CTGGAGGTAA GCAGTAAGAG
AAGGATCAGA TTTGGAGAGG CTGAATCTCT GATTCTCTCT GGTGTTTAAA GAGTTTGTTC AATTCGAATT GTGGGTTTAA
TTTTGGTGCC GTCTCTCACT GGGAGGGATC ACTGGATCAC AGTTGTGCTG CTTCTGGGAA CGTTTTGGTT AATTCTATCA
GGTCTGTAGT TCTTCATGAT TTTTTTTTGA ATGGATGTAG TTCTTCATGA TAGCTTCTAG AATATCTGAG TCTTGCTAAT
ATTCCTTTTT TTTTTAATAG CAAGAGAATT TAGTGGTGCT GACATACTAA AAATTAGAAG GTTTATGTGC TGTATGGGCA
TGTTCAGATA TTTTGATTTG TTAGGCAAAT TTAGATATTT TTAACCATGG CGACCTTTTG GTTTGGGGGC ATAATTGGGA
GCTTGGTTTT GCTTCCTTTT TTTTGAACGG AAGTTTTGCT TGTTTCATGC GTTCTCTTTG GAAATAATAA TTCTAGTACG
TTTTGCTGTG ATGAATTCAA GCCTCTATTT TAGTATACCG ATGAAACAAT TGTGCATTTC AAGGCAACTT TTGCTTTTCA
GCATAACTAA CAGCATAACA GTGAACAGAT AGTATAATAA TAACAGTAAC TACAAATTCT GCTTTGCCTA TCACTCAATC
TTGTATGAAC CTCTTTTCTT ATCCAATAAT ATTTTGTCTA TCTTATAGGT GCCATACTGG ACTGGCTTGC TTGTTAACTG
GGTTAGCCAG GGACTCCGGT ATTATACTAC TATGATCAGT TCGTGTACTT TTTTTCGCCG GGCAAGTTTC CCCAAGGAAC
TCTTTTGATG CTGTAATTAT AACTGAAGAG TCATGGATCT GCTCAGCGTC CTCCTAATTA TAGCATCTCT GCTCCCATTT
TCAGCATCTG ACCGTCAAGG TTTATTTACA TGCCTATCAT TTATGTAGTT ATTCAAGCTA TTTTGGAGTG CTTCCACAAT
CATGAGTTTG CAAATACTTT TGGGTAATAA ATAAATTTCT TTTATTTCCT TAGGTGATGC ACTATATGAT ATGAAGCTGA
AGCTGAATGC TACTGGTAAC CAGCTTTCTG ACTGGAACCA AAATCAAGTT AACCCATGCA CTTGGAATTC TGTTATTTGT
GACAACAACT ACAATGTTGT GCAAGTGTAA GTTTATTTTG TTGATGTTTT GCTTCACTTT TATTTTCTCT CCATTTTGAG
TTAATTCTAT ATTTACGTAT CTCTTAAACT TATATGGCAT AATAGTTCTT GATTTATGTT CCACATTCAT TACCAGTGAG
CTCCAGAAGC ATCTGTTTGA GCACATGATT ATGATTTTTT TGATGCACTT GCACATGCTA TCTGCACTTC TTTGATGCAC
GAGCACATTT CATAATTGAA CTATATGAAA ATGGAAAAAT CATACAACAT GCTGTTTCTT TAAATCTTCT TCACACCATC
TGTTATTTCT GGCAAAACAA CATCTAGATG GTTCTGTTGA CCCCGTTATG CATGTTCCAT ATCTAGGTTT TTTGTTTGTT
CCAAGTTGGT GTGCCTGATG ACAGATGCCC TCCTGCAGAA CATTGGCATC TATGGGATTC ACTGGAGTTC TATCACCACG
AATTGGAGAG CTTCAGTTTT TGAATGTTTT GTAAGTGTAC TTGTGTTGAT TGTTGGAATT TCTCTCAGAT ATTTGGTGGT
AGTTGTGATG AAATAGCTAC TGTGATCCTA GAGGAAACCA GAAGCTGGTA TTATGTGAGA AGTGCCAACT GTTAGCTATT
TCTGTGCTTG CTGCCCAAAG ATTTGGTTGT CTTAGTTACC ATGTACTGTG GTCTTAGACT CCAGTTTTTG CTAACCACTG
TAGTGCATGT CATTGCAGGT CCTTGCCTGG TAATAAGATT ACTGGTGGCA TACCTGAGCA GATCGGCAAC CTATCTAGTT
TGACAAGTTT GGATTTGGAA GACAATTTGT TGGTTGGACC AATACCGGCT TCTCTTGGCC AGCTTTCAAA GCTCCAAATT
CTGTATGTAC TTGAACCTTA GTCCTTTGTT TTATGAATGT ATAATGATTT AACCTGCTCA CCTTTTTATC TCTTAAACAG
GATACTAAGT CAAAACAATC TCAACGGAAC TATACCTGAT ACTGTAGCAA GAATCTCAAG CTTGACAGAC ATGCAAGGAC
TCATACATGA TTTCTGTTGA CAACAGTCCA TGCCTGAATT ATTTGACTAA CATATTTTTT TTCTTATGAT TGCAGTAGGT
TAGCCTACAA TAAACTCTCT GGTTCAATAC CTGGTTCGCT GTTTCAAGTT GCACGTTACA AGTACTGTTG GATCACTGTG
ACTTGTATAC TCATGTTTTT TCAAGTTTGA GCTTTGAGTT CTGACAAATG TTAATTTTCT TTACAGCTTT TCTGGTAATA
ACTTGACTTG TGGAGCAAAC TTTCTGCATC CATGCTCATC AAGTATTTCT TATCAAGGTA GGAAGCAATT TTTTCCCTGT
TCAACATTGC ACATCTGTCA TACAGCATCC ATTGGATGCC TGTCAGAATT TTCGCTGGAA TATGCTAATT CTATCTGTTT
AATAGGTTCA TCCCATGGCT CAAAGGTAGG CATTGTACTC GGAACAGTTG TAGGAGCAAT AGGGATACTT ATAATAGGGG
CTGTGTTTAT TGTCTGTAAT GGAAGGAGGA AAAGCCATCT ACGAGAAGTT TTTGTCGATG TATCAGGTAG TATTTTACTT
CATGATTTTC TTTCTATCCA TTCATTCAAC TAAACCTTTT CCTACAGTCT TGTTTATTAT TTTATTGAAA CAAAGATGTA
AATTATGCCG CAAAATTTTA TCATGCGACC CCCAAAACAA AAACAGTGCA AGCAGAGATA ACTCACACAT GTTGGTTTAT
TTCTAAACTA TGGTTTCCAG GTTGTGTATG TCAACACAGC TATTTTTACT GGCAGTTTCG CTTACTGCTC CATGTTTAAT
AAATAATCTT GGTGAAGTAT TTTGGTCAAA AAAATTTATG GCAAAATAAG AAAAAAAAAG TAGCATGCAA TATGCAAAGC
TGTCAAGTGT TTAGCACCTT CAGTAATTTT CTGATAAAAG ATATGGAAGG TTGTTTCTAA GGTAGCGTTT CAATTTACAA
ATTTAGGATT AGGATATGCA TAGGCTGCAT TTACATTTAG TCAAGAGTAA TTTTAGTTAA CTAATCTGTA ACTTATGTCC
CCAGGCGAGG ACGATCGAAG AATTGCATTT GGTCAGTTGA AAAGATTTGC CTGGCGAGAA TTACAACTTG CAACCGATAG
TTTCAGTGAG AAAAATGTCC TTGGACAGGG GGGTTTCGGT AAAGTGTATA AAGGAGCACT TCCAGATGGC ACTAAGATTG
CTGTAAAGCG GTTGACAGAT TATGAAAGCC CTGGTGGGGA GGCTGCATTC TTGCGTGAAG TAGAGCTTAT CAGTGTTGCA
GTTCACCGGA ATCTTTTAAG ATTGATTGGC TTCTGTACAA CACAAACAGA ACGTCTACTT GTTTATCCTT TCATGCAGAA
TCTTAGTGTG GCCTATCGTT TACGAGGTAC TTTCTATAAC TGATCAATAA TTTGTTTCGT TCTTCCAATT TTATGCTTCT
ACTACTGTAC TATAAAGTTT CTCGGATACT TCACTATTGT GCCTATGGAT TATGCAACTG ATACTTGTAG TGCTTTTAAT
TTACGCTTGT TGGGTAATAT GGTGCATGTG CACTATTGAT TTCAACATCG CATATGCTCA CTTTCTTATG TTTAGATTCA
ATATTGGAAG ATTTCAATAT GTACCTCATT GTGTTTAACG ATGCAGAATT CAAACCTGGC GAACCAATAt tggattggtc
agcaaggaaa cgtgtggcaa taggcacagc acgtggactg gagtacctgc acgagcactg taatcccaag atcatacatc
gagatgtcaa ggctgccaac gtcctgcttg atgaggattt tgagccagtt gttggtgact ttggcctggc aaagttggtt
gatgtacaga agacatcagt gacaactcaa gtccgtggaa ctatgggtca cattgcgcct gaatatctgt ccacagggaa
gtcatcggag agaactgatg tttttggtta tggcataatg cttcttgagc tggtcactgg acaacgcgcc atcgacttcT
CACGGTTGGA GGAAGAAGAC GATGTGCTAC TGCTTGACCA TGTGAGTCTA CTCTTGCGAA GCTGGAACAA AATTATCCTA
GCCTCTGATA GCCATGTGTT GACATAATTG AACGAATTTT TTTTGAAACT AACTGTGCCA GATAGTGCGA AATTTCATAC
TGATATAGCA AGAAAAATTA TAAAAATACA GCATGAGAGG CTATAATCAG CAGGAAAAGA AAAAAAACAA AATAATTGTT
GCTCTCATTG AACATCATAT TCATTCTGAA GCCTGCACCG CTTGAATCAT CAGTGTCATG ATCATGCTTG CTGGTTGCTG
CTGAAAATGT GCAGGTGAAG AAGCTGCAGA GGGAAGGGCA GCTGGGCGCC ATCGTGGACC GGAACCTGAG CAGCAACTAC
GACGGGCAGG AGGTGGAGAT GATGATACAG ATCGCGCTGC TGTGCACACA GGCGTCGCCG GAGGACCGGC CGTCCATGTC
GGAGGTGGTG CGGATGCTGG AAGGGGAAGG ACTCGCGGAG CGGTGGGAGG AGTGGCAGCA GGTGGAGGTG ACGCGGCGGC
AGGACTACGA GCGGATGCAG CAGCGCTTCG ACTGGGGCGA GGACTCCATC TTCAACCAGG AAGCCATCGA GCTCTCCGCC
GGCAGATGAC GACTGCGTAC GTCCTGATGC ATGTCACTTC CCAATCCCAG TGTTAATAGA TATACATGTA TGTATATGTA
TGGTTGGCTC TTAGTTACCA TAGGGTTGGT TATGTCACTA AAGAACCCAT GTCAAGCCTC CATTTGTGTA GAGGAAAACA
GCTAGAGACG CATGTGTTCA GAGTTC

Locus: Os03g0703200

Loading...

Locus: Os03g0703200

Loading...