Os03t0703200-02

Locus

Os03g0703200

Description

Leucine-rich repeat receptor-like kinase, Control of anther development and pollen fertility under low temperature

RAP-DB Gene Symbol Synonym(s)

TMS10L

RAP-DB Gene Name Synonym(s)

TMS10-Like

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSERL8, OsBAK1-6, SERL8, BAK1-6, TMS10L

Oryzabase Gene Name Synonym(s)

SERK-like gene 8, bri1-associated receptor kinase 1 (BAK1) homologue 6, TMS10-Like, Thermo-Sensitive Genic Male Sterile 10-like

Transcript Evidence

Inferred from literature

Protein Evidence

Q75I96

Literature

PMID: 29087306

Note

Manual Curation

December 6, 2017

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Leucine-rich repeat domain superfamily (IPR032675)

Protein kinase-like domain superfamily (IPR011009)

Leucine-rich repeat-containing N-terminal, plant-type (IPR013210)

Protein kinase domain (IPR000719)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Others

Oryzabase (13031)

Transcript

2396 bp

>Os03t0703200-02 Leucine-rich repeat receptor-like kinase, Control of anther development and pollen fertility under low temperature
ATGAATTCAAGCCTCTATTTTAGTATACCGATGAAACAATTGTGCATTTCAAGGCAACTT
TTGCTTTTCAGCATAACTAACAGCATAACAGTGAACAGATAGTATAATAATAACAGTAAC
TACAAATTCTGCTTTGCCTATCACTCAATCTTGTATGAACCTCTTTTCTTATCCAATAAT
ATTTTGTCTATCTTATAGGTGCCATACTGGACTGGCTTGCTTGTTAACTGGGTTAGCCAG
GGACTCCGGTATTATACTACTATGATCAGTTCGTGTACTTTTTTTCGCCGGGCAAGTTTC
CCCAAGGAACTCTTTTGATGCTGTAATTATAACTGAAGAGTCATGGATCTGCTCAGCGTC
CTCCTAATTATAGCATCTCTGCTCCCATTTTCAGCATCTGACCGTCAAGGTGATGCACTA
TATGATATGAAGCTGAAGCTGAATGCTACTGGTAACCAGCTTTCTGACTGGAACCAAAAT
CAAGTTAACCCATGCACTTGGAATTCTGTTATTTGTGACAACAACTACAATGTTGTGCAA
GTAACATTGGCATCTATGGGATTCACTGGAGTTCTATCACCACGAATTGGAGAGCTTCAG
TTTTTGAATGTTTTGTCCTTGCCTGGTAATAAGATTACTGGTGGCATACCTGAGCAGATC
GGCAACCTATCTAGTTTGACAAGTTTGGATTTGGAAGACAATTTGTTGGTTGGACCAATA
CCGGCTTCTCTTGGCCAGCTTTCAAAGCTCCAAATTCTGATACTAAGTCAAAACAATCTC
AACGGAACTATACCTGATACTGTAGCAAGAATCTCAAGCTTGACAGACATTAGGTTAGCC
TACAATAAACTCTCTGGTTCAATACCTGGTTCGCTGTTTCAAGTTGCACGTTACAACTTT
TCTGGTAATAACTTGACTTGTGGAGCAAACTTTCTGCATCCATGCTCATCAAGTATTTCT
TATCAAGGTTCATCCCATGGCTCAAAGGTAGGCATTGTACTCGGAACAGTTGTAGGAGCA
ATAGGGATACTTATAATAGGGGCTGTGTTTATTGTCTGTAATGGAAGGAGGAAAAGCCAT
CTACGAGAAGTTTTTGTCGATGTATCAGGCGAGGACGATCGAAGAATTGCATTTGGTCAG
TTGAAAAGATTTGCCTGGCGAGAATTACAACTTGCAACCGATAGTTTCAGTGAGAAAAAT
GTCCTTGGACAGGGGGGTTTCGGTAAAGTGTATAAAGGAGCACTTCCAGATGGCACTAAG
ATTGCTGTAAAGCGGTTGACAGATTATGAAAGCCCTGGTGGGGAGGCTGCATTCTTGCGT
GAAGTAGAGCTTATCAGTGTTGCAGTTCACCGGAATCTTTTAAGATTGATTGGCTTCTGT
ACAACACAAACAGAACGTCTACTTGTTTATCCTTTCATGCAGAATCTTAGTGTGGCCTAT
CGTTTACGAGAATTCAAACCTGGCGAACCAATAttggattggtcagcaaggaaacgtgtg
gcaataggcacagcacgtggactggagtacctgcacgagcactgtaatcccaagatcata
catcgagatgtcaaggctgccaacgtcctgcttgatgaggattttgagccagttgttggt
gactttggcctggcaaagttggttgatgtacagaagacatcagtgacaactcaagtccgt
ggaactatgggtcacattgcgcctgaatatctgtccacagggaagtcatcggagagaact
gatgtttttggttatggcataatgcttcttgagctggtcactggacaacgcgccatcgac
ttcTCACGGTTGGAGGAAGAAGACGATGTGCTACTGCTTGACCATGTGAAGAAGCTGCAG
AGGGAAGGGCAGCTGGGCGCCATCGTGGACCGGAACCTGAGCAGCAACTACGACGGGCAG
GAGGTGGAGATGATGATACAGATCGCGCTGCTGTGCACACAGGCGTCGCCGGAGGACCGG
CCGTCCATGTCGGAGGTGGTGCGGATGCTGGAAGGGGAAGGACTCGCGGAGCGGTGGGAG
GAGTGGCAGCAGGTGGAGGTGACGCGGCGGCAGGACTACGAGCGGATGCAGCAGCGCTTC
GACTGGGGCGAGGACTCCATCTTCAACCAGGAAGCCATCGAGCTCTCCGCCGGCAGATGA
CGACTGCGTACGTCCTGATGCATGTCACTTCCCAATCCCAGTGTTAATAGATATACATGT
ATGTATATGTATGGTTGGCTCTTAGTTACCATAGGGTTGGTTATGTCACTAAAGAACCCA
TGTCAAGCCTCCATTTGTGTAGAGGAAAACAGCTAGAGACGCATGTGTTCAGAGTTCAGA
CTTCAGAAGTCCCAAGTCGCATCTGCTTGGCGAAGCCGAGCCACATTTTCTACCAT

CDS

1818 bp

>Os03t0703200-02 Leucine-rich repeat receptor-like kinase, Control of anther development and pollen fertility under low temperature
ATGGATCTGCTCAGCGTCCTCCTAATTATAGCATCTCTGCTCCCATTTTCAGCATCTGAC
CGTCAAGGTGATGCACTATATGATATGAAGCTGAAGCTGAATGCTACTGGTAACCAGCTT
TCTGACTGGAACCAAAATCAAGTTAACCCATGCACTTGGAATTCTGTTATTTGTGACAAC
AACTACAATGTTGTGCAAGTAACATTGGCATCTATGGGATTCACTGGAGTTCTATCACCA
CGAATTGGAGAGCTTCAGTTTTTGAATGTTTTGTCCTTGCCTGGTAATAAGATTACTGGT
GGCATACCTGAGCAGATCGGCAACCTATCTAGTTTGACAAGTTTGGATTTGGAAGACAAT
TTGTTGGTTGGACCAATACCGGCTTCTCTTGGCCAGCTTTCAAAGCTCCAAATTCTGATA
CTAAGTCAAAACAATCTCAACGGAACTATACCTGATACTGTAGCAAGAATCTCAAGCTTG
ACAGACATTAGGTTAGCCTACAATAAACTCTCTGGTTCAATACCTGGTTCGCTGTTTCAA
GTTGCACGTTACAACTTTTCTGGTAATAACTTGACTTGTGGAGCAAACTTTCTGCATCCA
TGCTCATCAAGTATTTCTTATCAAGGTTCATCCCATGGCTCAAAGGTAGGCATTGTACTC
GGAACAGTTGTAGGAGCAATAGGGATACTTATAATAGGGGCTGTGTTTATTGTCTGTAAT
GGAAGGAGGAAAAGCCATCTACGAGAAGTTTTTGTCGATGTATCAGGCGAGGACGATCGA
AGAATTGCATTTGGTCAGTTGAAAAGATTTGCCTGGCGAGAATTACAACTTGCAACCGAT
AGTTTCAGTGAGAAAAATGTCCTTGGACAGGGGGGTTTCGGTAAAGTGTATAAAGGAGCA
CTTCCAGATGGCACTAAGATTGCTGTAAAGCGGTTGACAGATTATGAAAGCCCTGGTGGG
GAGGCTGCATTCTTGCGTGAAGTAGAGCTTATCAGTGTTGCAGTTCACCGGAATCTTTTA
AGATTGATTGGCTTCTGTACAACACAAACAGAACGTCTACTTGTTTATCCTTTCATGCAG
AATCTTAGTGTGGCCTATCGTTTACGAGAATTCAAACCTGGCGAACCAATAttggattgg
tcagcaaggaaacgtgtggcaataggcacagcacgtggactggagtacctgcacgagcac
tgtaatcccaagatcatacatcgagatgtcaaggctgccaacgtcctgcttgatgaggat
tttgagccagttgttggtgactttggcctggcaaagttggttgatgtacagaagacatca
gtgacaactcaagtccgtggaactatgggtcacattgcgcctgaatatctgtccacaggg
aagtcatcggagagaactgatgtttttggttatggcataatgcttcttgagctggtcact
ggacaacgcgccatcgacttcTCACGGTTGGAGGAAGAAGACGATGTGCTACTGCTTGAC
CATGTGAAGAAGCTGCAGAGGGAAGGGCAGCTGGGCGCCATCGTGGACCGGAACCTGAGC
AGCAACTACGACGGGCAGGAGGTGGAGATGATGATACAGATCGCGCTGCTGTGCACACAG
GCGTCGCCGGAGGACCGGCCGTCCATGTCGGAGGTGGTGCGGATGCTGGAAGGGGAAGGA
CTCGCGGAGCGGTGGGAGGAGTGGCAGCAGGTGGAGGTGACGCGGCGGCAGGACTACGAG
CGGATGCAGCAGCGCTTCGACTGGGGCGAGGACTCCATCTTCAACCAGGAAGCCATCGAG
CTCTCCGCCGGCAGATGA

Protein

606 aa

>Os03t0703200-02 Leucine-rich repeat receptor-like kinase, Control of anther development and pollen fertility under low temperature
MDLLSVLLIIASLLPFSASDRQGDALYDMKLKLNATGNQLSDWNQNQVNPCTWNSVICDN
NYNVVQVTLASMGFTGVLSPRIGELQFLNVLSLPGNKITGGIPEQIGNLSSLTSLDLEDN
LLVGPIPASLGQLSKLQILILSQNNLNGTIPDTVARISSLTDIRLAYNKLSGSIPGSLFQ
VARYNFSGNNLTCGANFLHPCSSSISYQGSSHGSKVGIVLGTVVGAIGILIIGAVFIVCN
GRRKSHLREVFVDVSGEDDRRIAFGQLKRFAWRELQLATDSFSEKNVLGQGGFGKVYKGA
LPDGTKIAVKRLTDYESPGGEAAFLREVELISVAVHRNLLRLIGFCTTQTERLLVYPFMQ
NLSVAYRLREFKPGEPILDWSARKRVAIGTARGLEYLHEHCNPKIIHRDVKAANVLLDED
FEPVVGDFGLAKLVDVQKTSVTTQVRGTMGHIAPEYLSTGKSSERTDVFGYGIMLLELVT
GQRAIDFSRLEEEDDVLLLDHVKKLQREGQLGAIVDRNLSSNYDGQEVEMMIQIALLCTQ
ASPEDRPSMSEVVRMLEGEGLAERWEEWQQVEVTRRQDYERMQQRFDWGEDSIFNQEAIE
LSAGR*

5'UTR

chr03:28258646..28258987 (- strand) : 342 bp

CDS

chr03:28258579..28258645 (- strand) : 67 bp

chr03:28258332..28258464 (- strand) : 133 bp

chr03:28257848..28257919 (- strand) : 72 bp

chr03:28257476..28257619 (- strand) : 144 bp

chr03:28257326..28257397 (- strand) : 72 bp

chr03:28257177..28257242 (- strand) : 66 bp

chr03:28257021..28257091 (- strand) : 71 bp

chr03:28256772..28256912 (- strand) : 141 bp

chr03:28255932..28256273 (- strand) : 342 bp

chr03:28255277..28255671 (- strand) : 395 bp

chr03:28254669..28254983 (- strand) : 315 bp

3'UTR

chr03:28254433..28254668 (- strand) : 236 bp

FASTA

>Os03t0703200-02 class=Sequence position=chr03:28254433..28258987 (- strand)
ATGAATTCAA GCCTCTATTT TAGTATACCG ATGAAACAAT TGTGCATTTC AAGGCAACTT TTGCTTTTCA GCATAACTAA
CAGCATAACA GTGAACAGAT AGTATAATAA TAACAGTAAC TACAAATTCT GCTTTGCCTA TCACTCAATC TTGTATGAAC
CTCTTTTCTT ATCCAATAAT ATTTTGTCTA TCTTATAGGT GCCATACTGG ACTGGCTTGC TTGTTAACTG GGTTAGCCAG
GGACTCCGGT ATTATACTAC TATGATCAGT TCGTGTACTT TTTTTCGCCG GGCAAGTTTC CCCAAGGAAC TCTTTTGATG
CTGTAATTAT AACTGAAGAG TCATGGATCT GCTCAGCGTC CTCCTAATTA TAGCATCTCT GCTCCCATTT TCAGCATCTG
ACCGTCAAGG TTTATTTACA TGCCTATCAT TTATGTAGTT ATTCAAGCTA TTTTGGAGTG CTTCCACAAT CATGAGTTTG
CAAATACTTT TGGGTAATAA ATAAATTTCT TTTATTTCCT TAGGTGATGC ACTATATGAT ATGAAGCTGA AGCTGAATGC
TACTGGTAAC CAGCTTTCTG ACTGGAACCA AAATCAAGTT AACCCATGCA CTTGGAATTC TGTTATTTGT GACAACAACT
ACAATGTTGT GCAAGTGTAA GTTTATTTTG TTGATGTTTT GCTTCACTTT TATTTTCTCT CCATTTTGAG TTAATTCTAT
ATTTACGTAT CTCTTAAACT TATATGGCAT AATAGTTCTT GATTTATGTT CCACATTCAT TACCAGTGAG CTCCAGAAGC
ATCTGTTTGA GCACATGATT ATGATTTTTT TGATGCACTT GCACATGCTA TCTGCACTTC TTTGATGCAC GAGCACATTT
CATAATTGAA CTATATGAAA ATGGAAAAAT CATACAACAT GCTGTTTCTT TAAATCTTCT TCACACCATC TGTTATTTCT
GGCAAAACAA CATCTAGATG GTTCTGTTGA CCCCGTTATG CATGTTCCAT ATCTAGGTTT TTTGTTTGTT CCAAGTTGGT
GTGCCTGATG ACAGATGCCC TCCTGCAGAA CATTGGCATC TATGGGATTC ACTGGAGTTC TATCACCACG AATTGGAGAG
CTTCAGTTTT TGAATGTTTT GTAAGTGTAC TTGTGTTGAT TGTTGGAATT TCTCTCAGAT ATTTGGTGGT AGTTGTGATG
AAATAGCTAC TGTGATCCTA GAGGAAACCA GAAGCTGGTA TTATGTGAGA AGTGCCAACT GTTAGCTATT TCTGTGCTTG
CTGCCCAAAG ATTTGGTTGT CTTAGTTACC ATGTACTGTG GTCTTAGACT CCAGTTTTTG CTAACCACTG TAGTGCATGT
CATTGCAGGT CCTTGCCTGG TAATAAGATT ACTGGTGGCA TACCTGAGCA GATCGGCAAC CTATCTAGTT TGACAAGTTT
GGATTTGGAA GACAATTTGT TGGTTGGACC AATACCGGCT TCTCTTGGCC AGCTTTCAAA GCTCCAAATT CTGTATGTAC
TTGAACCTTA GTCCTTTGTT TTATGAATGT ATAATGATTT AACCTGCTCA CCTTTTTATC TCTTAAACAG GATACTAAGT
CAAAACAATC TCAACGGAAC TATACCTGAT ACTGTAGCAA GAATCTCAAG CTTGACAGAC ATGCAAGGAC TCATACATGA
TTTCTGTTGA CAACAGTCCA TGCCTGAATT ATTTGACTAA CATATTTTTT TTCTTATGAT TGCAGTAGGT TAGCCTACAA
TAAACTCTCT GGTTCAATAC CTGGTTCGCT GTTTCAAGTT GCACGTTACA AGTACTGTTG GATCACTGTG ACTTGTATAC
TCATGTTTTT TCAAGTTTGA GCTTTGAGTT CTGACAAATG TTAATTTTCT TTACAGCTTT TCTGGTAATA ACTTGACTTG
TGGAGCAAAC TTTCTGCATC CATGCTCATC AAGTATTTCT TATCAAGGTA GGAAGCAATT TTTTCCCTGT TCAACATTGC
ACATCTGTCA TACAGCATCC ATTGGATGCC TGTCAGAATT TTCGCTGGAA TATGCTAATT CTATCTGTTT AATAGGTTCA
TCCCATGGCT CAAAGGTAGG CATTGTACTC GGAACAGTTG TAGGAGCAAT AGGGATACTT ATAATAGGGG CTGTGTTTAT
TGTCTGTAAT GGAAGGAGGA AAAGCCATCT ACGAGAAGTT TTTGTCGATG TATCAGGTAG TATTTTACTT CATGATTTTC
TTTCTATCCA TTCATTCAAC TAAACCTTTT CCTACAGTCT TGTTTATTAT TTTATTGAAA CAAAGATGTA AATTATGCCG
CAAAATTTTA TCATGCGACC CCCAAAACAA AAACAGTGCA AGCAGAGATA ACTCACACAT GTTGGTTTAT TTCTAAACTA
TGGTTTCCAG GTTGTGTATG TCAACACAGC TATTTTTACT GGCAGTTTCG CTTACTGCTC CATGTTTAAT AAATAATCTT
GGTGAAGTAT TTTGGTCAAA AAAATTTATG GCAAAATAAG AAAAAAAAAG TAGCATGCAA TATGCAAAGC TGTCAAGTGT
TTAGCACCTT CAGTAATTTT CTGATAAAAG ATATGGAAGG TTGTTTCTAA GGTAGCGTTT CAATTTACAA ATTTAGGATT
AGGATATGCA TAGGCTGCAT TTACATTTAG TCAAGAGTAA TTTTAGTTAA CTAATCTGTA ACTTATGTCC CCAGGCGAGG
ACGATCGAAG AATTGCATTT GGTCAGTTGA AAAGATTTGC CTGGCGAGAA TTACAACTTG CAACCGATAG TTTCAGTGAG
AAAAATGTCC TTGGACAGGG GGGTTTCGGT AAAGTGTATA AAGGAGCACT TCCAGATGGC ACTAAGATTG CTGTAAAGCG
GTTGACAGAT TATGAAAGCC CTGGTGGGGA GGCTGCATTC TTGCGTGAAG TAGAGCTTAT CAGTGTTGCA GTTCACCGGA
ATCTTTTAAG ATTGATTGGC TTCTGTACAA CACAAACAGA ACGTCTACTT GTTTATCCTT TCATGCAGAA TCTTAGTGTG
GCCTATCGTT TACGAGGTAC TTTCTATAAC TGATCAATAA TTTGTTTCGT TCTTCCAATT TTATGCTTCT ACTACTGTAC
TATAAAGTTT CTCGGATACT TCACTATTGT GCCTATGGAT TATGCAACTG ATACTTGTAG TGCTTTTAAT TTACGCTTGT
TGGGTAATAT GGTGCATGTG CACTATTGAT TTCAACATCG CATATGCTCA CTTTCTTATG TTTAGATTCA ATATTGGAAG
ATTTCAATAT GTACCTCATT GTGTTTAACG ATGCAGAATT CAAACCTGGC GAACCAATAt tggattggtc agcaaggaaa
cgtgtggcaa taggcacagc acgtggactg gagtacctgc acgagcactg taatcccaag atcatacatc gagatgtcaa
ggctgccaac gtcctgcttg atgaggattt tgagccagtt gttggtgact ttggcctggc aaagttggtt gatgtacaga
agacatcagt gacaactcaa gtccgtggaa ctatgggtca cattgcgcct gaatatctgt ccacagggaa gtcatcggag
agaactgatg tttttggtta tggcataatg cttcttgagc tggtcactgg acaacgcgcc atcgacttcT CACGGTTGGA
GGAAGAAGAC GATGTGCTAC TGCTTGACCA TGTGAGTCTA CTCTTGCGAA GCTGGAACAA AATTATCCTA GCCTCTGATA
GCCATGTGTT GACATAATTG AACGAATTTT TTTTGAAACT AACTGTGCCA GATAGTGCGA AATTTCATAC TGATATAGCA
AGAAAAATTA TAAAAATACA GCATGAGAGG CTATAATCAG CAGGAAAAGA AAAAAAACAA AATAATTGTT GCTCTCATTG
AACATCATAT TCATTCTGAA GCCTGCACCG CTTGAATCAT CAGTGTCATG ATCATGCTTG CTGGTTGCTG CTGAAAATGT
GCAGGTGAAG AAGCTGCAGA GGGAAGGGCA GCTGGGCGCC ATCGTGGACC GGAACCTGAG CAGCAACTAC GACGGGCAGG
AGGTGGAGAT GATGATACAG ATCGCGCTGC TGTGCACACA GGCGTCGCCG GAGGACCGGC CGTCCATGTC GGAGGTGGTG
CGGATGCTGG AAGGGGAAGG ACTCGCGGAG CGGTGGGAGG AGTGGCAGCA GGTGGAGGTG ACGCGGCGGC AGGACTACGA
GCGGATGCAG CAGCGCTTCG ACTGGGGCGA GGACTCCATC TTCAACCAGG AAGCCATCGA GCTCTCCGCC GGCAGATGAC
GACTGCGTAC GTCCTGATGC ATGTCACTTC CCAATCCCAG TGTTAATAGA TATACATGTA TGTATATGTA TGGTTGGCTC
TTAGTTACCA TAGGGTTGGT TATGTCACTA AAGAACCCAT GTCAAGCCTC CATTTGTGTA GAGGAAAACA GCTAGAGACG
CATGTGTTCA GAGTTCAGAC TTCAGAAGTC CCAAGTCGCA TCTGCTTGGC GAAGCCGAGC CACATTTTCT ACCAT

Locus: Os03g0703200

Loading...

Locus: Os03g0703200

Loading...