Os03t0704200-01

Locus

Os03g0704200

Description

Zinc finger, MYND-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET17, SDG716

Oryzabase Gene Name Synonym(s)

SET protein 17

Transcript Evidence

AK071176 (DDBJ, Best hit)

Protein Evidence

Q10E92 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, MYND-type (IPR002893)

Full-length cDNA

J023083O08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0704200-01)

RiceXPro (AK071176)

Others

Oryzabase (13382)

KEGG (Os03t0704200-01)

Transcript

1847 bp

>Os03t0704200-01 Zinc finger, MYND-type domain containing protein.
gtaggcgccacgtcagccaaaaccgctcttaaaaccaccgagggatctcatctgcaccgg
ttttgatagttgagggacccgttgtgtctggtttttcggttgagggacCTCAAATGAACT
TATTCCTTTTTTTTTTTTCGAACCTTCTCGAGAGGAGAGGCGTCGGGGCGGGGGGAATGG
CGTCGTGGGAGGAGCAGCTGCGGGACGAGCTCGCCGGCCGAGACCTCGCCGTCGCCTCCG
TCCCCGGGAAGGGCCGCGGCCTCTTCGCCGCACGCAGCTTCTTCCCAGGAGAAGTCGTTA
TTTCGCAAGAGCCTTACGCTTCTACACCAAACAAGATTTCTGTGGGCTCCAACTGCGACA
ATTGTTTCGCCTCCAGAAACCTGAGGAAGTGCTCCGTTTGTCGAGTTGCTTGGTACTGTG
GGAGTGCGTGTCAGAGAGAAGAATGGAAGCTTCATCAACTTGAATGTCGAGCAATCGCCG
CGCTTACAGAGGATAGAAAGAAGATGCTTACTCCCACAATTCGTTTGATGGTGCGGCTTG
TACTTAGAAGAAAACTGCAGGATGACAAGGCTATTCCATCTTCAGGAACAGATAACTACA
ATCTAGTGGATGCATTAGAATCCCACCGCATAATATAGACATCTCCGAGGTTGATAAAAA
TCAACTGGTTTTATATGCTCAGATGGCCAATCTTGTCCAACTGATTCTTCCTTCATTCGA
GCTTGATCTTAAGGAAATTACACATACCTTTTCCAAGTTTGCCTGCAACGCTCATACCAT
ATGTGATCCTGAACTGAGGCCCCTTGGGACTGGACTATACCCTGTTTTATCTATTATTAA
CCACAGTTGTGTACCAAATGCAGTTTTGATATTTGAAGGTCGGACAGCATATGTTCGTGC
ATTGCAACCTATAAGTAAAAATGAGGAGGTATCAATAAGTTACATTGAAACTGCGGCAAC
CACTATGAAGAGACAGGACGATCTCAAGCACTACTACTTCACTTGCACATGTCCCCGTTG
TGTTAAGGATTCTGAGGAAGATGCGCTCCTTGAGGGATACAGATGCAATGACCAAAAGTG
TGATGGATTTCTTCTGCCTAATGCAGGAAACAAAGGTTATACATGCCAGAAATGTAGCAC
TTCTAGAGATGGGGAAGAGTTACAAAAGATGGCTAGCGATGTACTACTATTATCTGACAA
AGTCTCTTCCTTAGTTTCATCTGGAATAGATAACAGTGAGGTAGGTTCTATGTACAAGAC
CATTGAAGAGCTAGAGCGGAAGCTTTACCATCCTTTGTCAATCACTTTGCTTCACACACG
GGAAACACTCTTGAAGATATATATGGAGTTACAAGATTGGCAGACTGCATTGATGTATTG
CAGATTGACAATTCCAGTTTATGAAAGAATTTACCCACCTTTTCACCCAATGATTGGATT
ACAGTTCTATACTTGCGGAAAGCTTGAATGGTTGCTTGAGTACACAGAGGATGCTCTGAT
GTCTTTAACCAGGGCAGCAGATATACTTCGCATAACGCATGGGACTAAATCCGAGTTCAT
GAAGGAACTTTTGGGCAAGCTAGAAGAAGTAAGGGCTGAAGCTTCTTTTAGGCTCTCGGC
TGGAGATGAACAATAATTGAGTAACCATTTTATTGTGAAGCTCCAGGTCATCGTGATGGC
AAATAGAATGTAACAATGTTGCAACAATGTTCAAATAGGATAGTACTAAGTAGACAATCT
CTAAATTTAGAATAGCTTTGTTAATTCAACATTGGGATATAAGCTGCCCTGAAGGGCTCG
CATCGGGACAAGAACTGTGAACTGGTGATATGGAAAATTCATTGTTC

CDS

525 bp

>Os03t0704200-01 Zinc finger, MYND-type domain containing protein.
ATGAACTTATTCCTTTTTTTTTTTTCGAACCTTCTCGAGAGGAGAGGCGTCGGGGCGGGG
GGAATGGCGTCGTGGGAGGAGCAGCTGCGGGACGAGCTCGCCGGCCGAGACCTCGCCGTC
GCCTCCGTCCCCGGGAAGGGCCGCGGCCTCTTCGCCGCACGCAGCTTCTTCCCAGGAGAA
GTCGTTATTTCGCAAGAGCCTTACGCTTCTACACCAAACAAGATTTCTGTGGGCTCCAAC
TGCGACAATTGTTTCGCCTCCAGAAACCTGAGGAAGTGCTCCGTTTGTCGAGTTGCTTGG
TACTGTGGGAGTGCGTGTCAGAGAGAAGAATGGAAGCTTCATCAACTTGAATGTCGAGCA
ATCGCCGCGCTTACAGAGGATAGAAAGAAGATGCTTACTCCCACAATTCGTTTGATGGTG
CGGCTTGTACTTAGAAGAAAACTGCAGGATGACAAGGCTATTCCATCTTCAGGAACAGAT
AACTACAATCTAGTGGATGCATTAGAATCCCACCGCATAATATAG

Protein

175 aa

>Os03t0704200-01 Zinc finger, MYND-type domain containing protein.
MNLFLFFFSNLLERRGVGAGGMASWEEQLRDELAGRDLAVASVPGKGRGLFAARSFFPGE
VVISQEPYASTPNKISVGSNCDNCFASRNLRKCSVCRVAWYCGSACQREEWKLHQLECRA
IAALTEDRKKMLTPTIRLMVRLVLRRKLQDDKAIPSSGTDNYNLVDALESHRII*

5'UTR

chr03:28312157..28312269 (- strand) : 113 bp

CDS

chr03:28311982..28312156 (- strand) : 175 bp

chr03:28311620..28311765 (- strand) : 146 bp

chr03:28311330..28311464 (- strand) : 135 bp

chr03:28311156..28311210 (- strand) : 55 bp

chr03:28311072..28311085 (- strand) : 14 bp

3'UTR

chr03:28310953..28311071 (- strand) : 119 bp

chr03:28310393..28310481 (- strand) : 89 bp

chr03:28310212..28310293 (- strand) : 82 bp

chr03:28310002..28310100 (- strand) : 99 bp

chr03:28309819..28309897 (- strand) : 79 bp

chr03:28309559..28309678 (- strand) : 120 bp

chr03:28309345..28309454 (- strand) : 110 bp

chr03:28309188..28309257 (- strand) : 70 bp

chr03:28309041..28309104 (- strand) : 64 bp

chr03:28308368..28308744 (- strand) : 377 bp

FASTA

>Os03t0704200-01 class=Sequence position=chr03:28308368..28312269 (- strand)
gtaggcgcca cgtcagccaa aaccgctctt aaaaccaccg agggatctca tctgcaccgg ttttgatagt tgagggaccc
gttgtgtctg gtttttcggt tgagggacCT CAAATGAACT TATTCCTTTT TTTTTTTTCG AACCTTCTCG AGAGGAGAGG
CGTCGGGGCG GGGGGAATGG CGTCGTGGGA GGAGCAGCTG CGGGACGAGC TCGCCGGCCG AGACCTCGCC GTCGCCTCCG
TCCCCGGGAA GGGCCGCGGC CTCTTCGCCG CACGCAGCTT CTTCCCAGGT AAACCCAACC CCCCCTTCTC TGATCGAAAG
GCGGGCGCTG TGCCATGGTG GCCAAGCAAG GCAGGGGGCG GCTGCTCGCG AACCGCTCGG CGAAATGCCC AGGCGGAAGG
CTTGAGGCCA TCCGTAGTGG ATGCTGCTGC AATGCGGTTT CATTGAGTTG GGATTATGGT TCCTGTTGCC GCGATGATGA
TGATGGGGGG TTCTGCGTCT GCAGGAGAAG TCGTTATTTC GCAAGAGCCT TACGCTTCTA CACCAAACAA GATTTCTGTG
GGCTCCAACT GCGACAATTG TTTCGCCTCC AGAAACCTGA GGAAGTGCTC CGTTTGTCGA GTTGCTTGGT ACTGTGGGAG
TGCGTGTCAG GTGCTGACTC TGTCCTTCAA CTGTTACACG CATTTGATAT GCAGAGACTT GCTTTTGTGA TCATGTGCTG
TGCGGAGACT GTTACATGCA TTATTTATAG TGATTCCTCT TGCTTTCAAT GGTGTAACTT TTTTGGCGAT ATGTTGCTAC
CGCAGAGAGA AGAATGGAAG CTTCATCAAC TTGAATGTCG AGCAATCGCC GCGCTTACAG AGGATAGAAA GAAGATGCTT
ACTCCCACAA TTCGTTTGAT GGTGCGGCTT GTACTTAGAA GAAAACTGCA GGATGACAAG GTATTGTCTA GTTGATTGAT
GTAAAAATAT AATGCATCAT GTCAATGATG ATATTTTTGT ATACATGGCA TGTTGAAGTT TTCTGCATGT TGGTAACTTG
ATATTGGTTG TTTTGCCAGG CTATTCCATC TTCAGGAACA GATAACTACA ATCTAGTGGA TGCATTAGAA TCCCGTATCC
TTCCCTTTTG ATACATTTGA TCCATGACAA ATATATTGAC TTTGATTTTG TGAATGTTTT ATTGACCGCA TAATATAGAC
ATCTCCGAGG TTGATAAAAA TCAACTGGTT TTATATGCTC AGATGGCCAA TCTTGTCCAA CTGATTCTTC CTTCATTCGA
GCTTGATCTT AAGGAAATTA CACATACCTT TTCCAAGGTA ATGCTACTCA AAGTCATAAG GTTATAAAAA ATGTTTTAAC
TACTATAGAA GACAATGTAT CCAATGAATA ATTGAGCTTA AAAAATACAG TTGTTTCCTG GTGTTATTTT TGAGATTTTG
CTTGTACCTT CCATCTAAAA CCTATTGGGA CCTAGTTGGA TGTGATTAAT TTTGTTCCAA AACCATGAGG ATCCAAGTTA
TCTAGGACAC CTCCCTGTGG TCTTATACTC TTATTTGAGT ATAGTAGAAT CGTGTCTTGA ATCTGCCTTT TGAAAAATAA
ACCAGAATAA GCCAAGAAGC TTTGGAAAAA AAAAGAATAA TTGTTCTGTC CATGTTTATT CTTCCGTTTT TCATATTTGT
TGTCTTCCAG TCTCACCCTT AAGCAGTGGC TAGGACTATT TTGGTGATTA TCTGGCTAGA CCTTTAGAAG TAAGCATGAA
TAATATATCC TCTGCCTCAT ATGTGCAGTT TGCCTGCAAC GCTCATACCA TATGTGATCC TGAACTGAGG CCCCTTGGGA
CTGGACTATA CCCTGTTTTA TCTATTATTA ACCACAGGTG ATATACTATT CCTTTATTCA TCGTTTAGCA TCTTCCTCCG
ATTTTATCAT TTAATAAATA ATTATTATTG CATCTACCCT TTCCTGGTAT ACTTAGTTGT GTACCAAATG CAGTTTTGAT
ATTTGAAGGT CGGACAGCAT ATGTTCGTGC ATTGCAACCT ATAAGTAAAA ATGAGGAGGT AATGAATATA CTTTTGTTTT
TTTCCTTATT ATCATATATT CCTCTGCTTG CAATCCATGT TTCTTGGGGT TTCTTCTCTG GGCAATGTCA GTTACGCATC
TTTGGTTAGG TATCAATAAG TTACATTGAA ACTGCGGCAA CCACTATGAA GAGACAGGAC GATCTCAAGC ACTACTACTT
CACTTGCACA TGTCCCCGTT GTGTTAAGGT TTTTGATTTC ATTGCTTACT ATTCTTGGAT GTCCTATGGG AAGCTGACAC
ATTCTTGATA ATGAAGTGTT CTCTAGCTAT AATTTTTTCC CCAACCTTAC AGGATTCTGA GGAAGATGCG CTCCTTGAGG
GATACAGATG CAATGACCAA AAGTGTGATG GATTTCTTCT GCCTAATGCA GGTTGGTTAA CATCACGAAG GAAAAATACT
AACTGAAGAG ATGTAATAGA TTGGATTATT CAAACATAAT GTCAGCTGCA GCTTTAATAC TGTTTCAGTT ATCATTGATC
TTACATTTTT ATCTGGATTT AACATCTGTA GGAAACAAAG GTTATACATG CCAGAAATGT AGCACTTCTA GAGATGGGGA
AGAGTTACAA AAGATGGCTA GCGATGTACT ACTATTATCT GACAAAGTCT CTTCCTTAGT TTCATCTGGA AGTATCCTTT
TTCACTATTA CTAGATGCTA TCTGAGGCAA ATGTATATAA TTATTGCATC ATATTTTTTT GTGATTTTGT AAAATGCTAC
CTTAACTTTG GGCAGTAGAT AACAGTGAGG TAGGTTCTAT GTACAAGACC ATTGAAGAGC TAGAGCGGAA GCTTTACCAT
CCTTTGTCAA TCACTTTGCT TCACACACGG GAAACACTCT TGAAGGTATA TTTTCAGCAT TAACAGTAAA AATAACCTGC
TAGGGTACAG AGCACACCAT CTAGTATGAT TAACCACCTA TTATTTGTGC AGATATATAT GGAGTTACAA GATTGGCAGA
CTGCATTGAT GTATTGCAGA TTGACAATTC CAGTTTATGA AAGTAAGGCA CTTCTCTTCT TACAGCGTGC AGTCTCACAC
TTACATAAAA CTCAATGATC ACTAATGTTG TTGCACTTCT GCCAGGAATT TACCCACCTT TTCACCCAAT GATTGGATTA
CAGTTCTATA CTTGCGGAAA GCTTGAATGG TATGGAATAC TTTTCCCTAT TCACCTACTT ACTGTGTTCA TATATCGCGG
AGTAACAACT TTCATTGTCC AGTATAAGCT TTGGCCTTTG GCTATTTCAT GTTACTAAAA CAAGTTAGCT GAATTAATGC
TAGTAGGATA GCTGGATAGG GACATGCTTT TTCAAAAGCT TCAGTGAAAT GCTGTCAATA GCTTACCCAG AAGTCTGTTC
GAAATTCCTT GAGTCTTGAA TATTTGTACC CTTAAAGGGT CACACTCATG ATGTTTACAG TTACATCTAG ATGTTCCTGT
TGCAGGTTGC TTGAGTACAC AGAGGATGCT CTGATGTCTT TAACCAGGGC AGCAGATATA CTTCGCATAA CGCATGGGAC
TAAATCCGAG TTCATGAAGG AACTTTTGGG CAAGCTAGAA GAAGTAAGGG CTGAAGCTTC TTTTAGGCTC TCGGCTGGAG
ATGAACAATA ATTGAGTAAC CATTTTATTG TGAAGCTCCA GGTCATCGTG ATGGCAAATA GAATGTAACA ATGTTGCAAC
AATGTTCAAA TAGGATAGTA CTAAGTAGAC AATCTCTAAA TTTAGAATAG CTTTGTTAAT TCAACATTGG GATATAAGCT
GCCCTGAAGG GCTCGCATCG GGACAAGAAC TGTGAACTGG TGATATGGAA AATTCATTGT TC

Locus: Os03g0704200

Loading...

Locus: Os03g0704200

Loading...