Os03t0710800-01

Locus

Os03g0710800

Description

Member of the 14-3-3 protein family, Negative regulation of grain filling of inferior spikelets, Response to biotic and abiotic stress

RAP-DB Gene Symbol Synonym(s)

GF14f, SR14-3-3

RAP-DB Gene Name Synonym(s)

G-box factor 14-3-3f

CGSNL Gene Symbol

GF14F

CGSNL Gene Name

G-BOX FACTOR 14-3-3F PROTEIN

Oryzabase Gene Symbol Synonym(s)

GF14f, SR14-3-3, OsGF14f, S94, ric1, 14-3-3f

Oryzabase Gene Name Synonym(s)

G-box factor 14-3-3f protein, ras-related small GTP-binding protein ric1

Transcript Evidence

AK062077

AK103065

Protein Evidence

Q06967

Literature

PMID: 30912217

PMID: 16766513

Note

Manual Curation

May 7, 2019

Gene Ontology (GO)

Molecular Function: protein domain specific binding (GO:0019904)

Functional domain (InterPro)

14-3-3 domain superfamily (IPR036815)

14-3-3 protein (IPR000308)

14-3-3 domain (IPR023410)

14-3-3 protein, conserved site (IPR023409)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

001-044-F06 (Online Clone Ordering)

J033117N24 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0710800-01)

RiceXPro (AK062077)

Others

Oryzabase (11412)

KEGG (Os03t0710800-01)

Transcript

1174 bp

>Os03t0710800-01 Member of the 14-3-3 protein family, Negative regulation of grain filling of inferior spikelets, Response to biotic and abiotic stress
CTCCACTCCCTCCGCTCCTCCGCTCCTCGCCTCTTTTACCCGCTCTTCCCCCCGATCTCC
CCGGACTCCCACAGCCGCAGCGAACAAATCCCGCGCGGGTTGGGAAGAGCGAGCTCGTGA
GGAGAGCAGAGGGAAAGCGCGAGGGGGAAGGAGGAGGAAAGGTGCACAAGGTCAGACTAA
GTTTGCGTTGAAGAACAAAGGAGAGGAAAAATGTCGCCTGCTGAGGCATCGCGTGAGGAG
AATGTGTACATGGCAAAGCTTGCCGAGCAGGCTGAGCGTTACGAGGAAATGGTCGAATTC
ATGGAGAAGGTGGCAAAGACCACTGATGTTGGTGAGCTCACCGTTGAGGAGCGGAACCTG
CTTTCTGTGGCTTACAAGAACGTGATTGGTGCTCGGAGGGCATCGTGGAGGATCATCTCT
TCTATTGAGCAGAAGGAGGAGAGCCGTGGGAATGAGGCATATGTTGCATCAATTAAGGAG
TACCGTAGCAGGATTGAAACTGAGCTCAGCAAGATCTGTGATGGTATCCTTAAGCTTCTG
GATTCCCACCTTGTCCCATCTGCCACTGCTGCAGAGTCCAAGGTGTTCTACCTGAAAATG
AAGGGTGACTACCACAGGTACCTTGCTGAGTTTAAGTCAGGAGCTGAGAGGAAGGAAGCA
GCTGAGAACACTCTTGTGGCATACAAGTCTGCCCAGGATATTGCACTCGCTGACCTGCCT
ACAACTCACCCGATAAGGCTTGGACTTGCACTGAACTTCTCAGTGTTCTACTATGAGATA
CTGAACTCACCAGACCGTGCTTGCAACCTTGCAAAGCAGGCGTTCGACGATGCTATTGCT
GAACTGGACACTCTTGGCGAGGAGTCTTACAAGGACAGCACCTTGATCATGCAACTTCTT
CGTGACAATCTGACTCTCTGGACCTCTGACAATGCGGAGGATGGTGGTGACGAGATCAAG
GAAGCAGCGAAGCCTGAAGGAGAGGGCCACTAATCTGTCCTGAAGTCTATTTCTGAGTCC
ATTTACTCAGCTACCTGCTGTATTACTGGATCATAAGATGTACTAGGATCAATTGCTATG
TGGAATCATAAGATTAGGGCTGCGTATGTCAAAATGTGTCGAGCTGAAGTACCCAGTGGA
CACAGTTTATGTGCACTACATTGCTTCCGTGACT

CDS

783 bp

>Os03t0710800-01 Member of the 14-3-3 protein family, Negative regulation of grain filling of inferior spikelets, Response to biotic and abiotic stress
ATGTCGCCTGCTGAGGCATCGCGTGAGGAGAATGTGTACATGGCAAAGCTTGCCGAGCAG
GCTGAGCGTTACGAGGAAATGGTCGAATTCATGGAGAAGGTGGCAAAGACCACTGATGTT
GGTGAGCTCACCGTTGAGGAGCGGAACCTGCTTTCTGTGGCTTACAAGAACGTGATTGGT
GCTCGGAGGGCATCGTGGAGGATCATCTCTTCTATTGAGCAGAAGGAGGAGAGCCGTGGG
AATGAGGCATATGTTGCATCAATTAAGGAGTACCGTAGCAGGATTGAAACTGAGCTCAGC
AAGATCTGTGATGGTATCCTTAAGCTTCTGGATTCCCACCTTGTCCCATCTGCCACTGCT
GCAGAGTCCAAGGTGTTCTACCTGAAAATGAAGGGTGACTACCACAGGTACCTTGCTGAG
TTTAAGTCAGGAGCTGAGAGGAAGGAAGCAGCTGAGAACACTCTTGTGGCATACAAGTCT
GCCCAGGATATTGCACTCGCTGACCTGCCTACAACTCACCCGATAAGGCTTGGACTTGCA
CTGAACTTCTCAGTGTTCTACTATGAGATACTGAACTCACCAGACCGTGCTTGCAACCTT
GCAAAGCAGGCGTTCGACGATGCTATTGCTGAACTGGACACTCTTGGCGAGGAGTCTTAC
AAGGACAGCACCTTGATCATGCAACTTCTTCGTGACAATCTGACTCTCTGGACCTCTGAC
AATGCGGAGGATGGTGGTGACGAGATCAAGGAAGCAGCGAAGCCTGAAGGAGAGGGCCAC
TAA

Protein

261 aa

>Os03t0710800-01 Member of the 14-3-3 protein family, Negative regulation of grain filling of inferior spikelets, Response to biotic and abiotic stress
MSPAEASREENVYMAKLAEQAERYEEMVEFMEKVAKTTDVGELTVEERNLLSVAYKNVIG
ARRASWRIISSIEQKEESRGNEAYVASIKEYRSRIETELSKICDGILKLLDSHLVPSATA
AESKVFYLKMKGDYHRYLAEFKSGAERKEAAENTLVAYKSAQDIALADLPTTHPIRLGLA
LNFSVFYYEILNSPDRACNLAKQAFDDAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD
NAEDGGDEIKEAAKPEGEGH*

5'UTR

chr03:28664068..28664228 (+ strand) : 161 bp

chr03:28665413..28665461 (+ strand) : 49 bp

CDS

chr03:28665462..28665868 (+ strand) : 407 bp

chr03:28665962..28666040 (+ strand) : 79 bp

chr03:28666403..28666525 (+ strand) : 123 bp

chr03:28667237..28667353 (+ strand) : 117 bp

chr03:28667466..28667522 (+ strand) : 57 bp

3'UTR

chr03:28667523..28667703 (+ strand) : 181 bp

FASTA

>Os03t0710800-01 class=Sequence position=chr03:28664068..28667703 (+ strand)
CTCCACTCCC TCCGCTCCTC CGCTCCTCGC CTCTTTTACC CGCTCTTCCC CCCGATCTCC CCGGACTCCC ACAGCCGCAG
CGAACAAATC CCGCGCGGGT TGGGAAGAGC GAGCTCGTGA GGAGAGCAGA GGGAAAGCGC GAGGGGGAAG GAGGAGGAAA
GGTGATCTCT TCTCTCCCCC CTTTTTCTTT TTTTTTTTTG CTTGTCTCGC TTTTTATTTT TTTGCTACCT TTACGGTTGC
TGGGATTTGG GGGAGTTGGT GGTTGGTTGG TTGGTTGGTG GTTGCGTGAA TCCGAGGGGT GAGGAGAAGG AGGTGGAGTG
TTCGTTCTTG ATCTTTCCCG CAGTTGCACT TCGATTTGAG ATTGCTCGGT ACGGATCTGC AGCTGTTGTT TTTGTTTGGA
ATCGTGTTAG ATCTAGGGTT GGAGGGTATG GCTGTGTGGG GTTCGAGGTC AGATCTGATG CGAAAGTTTA GGGTTCTTGG
TGACTGTGAG ATGTggctgt gtttagttca cgccgaagtt gtaagtttgg ttgaaaattg gaacgatgtg attgaaagtt
tgtgtgtgta tgacaggttg atgtgatggg aaaagttaga agtttggaaa aaaactttgg aactaaacac aCCTCGTTTT
ATTTTCTTGC CATGTTTACT GGAGATCGTG TTGGGGACTG TAGTGAAGAC TCGAGATCTG CGTGGAGGAA GCCTGTATTT
GATTATTCAC ACGAAATATG CACGCATAGC TGTTCCCCTT TCGAGCTAAT TCGGTTCATC GATCTATCGT TTTTTTACCT
ATTAGATGCA GTATGCCTCC GTTGAACTGC AGATCTAGTC ATTTCGCTGC TGTTCATGTT GTTTTGAACT GTTAGTCTGT
CTGCTTGCTC TTCTGTGGAA GAAGCAGCAG TGGCGCTGTC GTTTTCTTAG CTTGAGGTCT GGTGGTATTG GACTAGATCA
CTGGTTTGGC AGCCACTTTC TTGTTGATTT GTCTGACGGA ATCACTCGAA AAGTAAGAAA ATAAAATGGA GAAAGTACTC
TAGTGAAAGG GGGATGGACT AGAATATTTA GTTGCCTGAG AATGATTCCT TTCGTTCATG GAAAAGGCTT GCGCTTGTTG
TCTAATTGGG AAAATGATGT GCCATCCACT TGGTTGGAAT CTGGCAAAGT CGTGTGATTT GTATGATCTT CTTGGGTTTC
ATCCATTGTT CCTTGGGTGG ATGGTGTCTA TTATGCTTAT CTCCACTTGG GCTAGTTTTC CGAGAACCGT ATATGTTCTT
GTAAATGGTC CACAAGTGAT ATAGTAGGTT GTATCTGTGT AAGTGCTGAT ATGCATTATT TGCAGGTGCA CAAGGTCAGA
CTAAGTTTGC GTTGAAGAAC AAAGGAGAGG AAAAATGTCG CCTGCTGAGG CATCGCGTGA GGAGAATGTG TACATGGCAA
AGCTTGCCGA GCAGGCTGAG CGTTACGAGG AAATGGTCGA ATTCATGGAG AAGGTGGCAA AGACCACTGA TGTTGGTGAG
CTCACCGTTG AGGAGCGGAA CCTGCTTTCT GTGGCTTACA AGAACGTGAT TGGTGCTCGG AGGGCATCGT GGAGGATCAT
CTCTTCTATT GAGCAGAAGG AGGAGAGCCG TGGGAATGAG GCATATGTTG CATCAATTAA GGAGTACCGT AGCAGGATTG
AAACTGAGCT CAGCAAGATC TGTGATGGTA TCCTTAAGCT TCTGGATTCC CACCTTGTCC CATCTGCCAC TGCTGCAGAG
TCCAAGGTGT TCTACCTGAA AATGAAGGGT GACTACCACA GGTATTGATT TCTGGTGTTT CAGGAATTAG CAGTAGCTAA
CAGTTTACCT TTTTTGTGTT TCCTAAGGTT TATTTTCTGG TTTTGAATGT ATAGGTACCT TGCTGAGTTT AAGTCAGGAG
CTGAGAGGAA GGAAGCAGCT GAGAACACTC TTGTGGCATA CAAGTCTGCC CAGGTTGGCC TCCGTGTACT TTTGCCAATA
TATATGGTGT ATAGCGGTGA TATTTAGTTT GCTATATCAT TATATTTTTC TTGGAGTAGC TTTATAAGTT CTGATATTTT
TATGTCATTC CTACCAGTGA TTTTTTATCC TCCATGCTGT ATCTTCTTCA CCGTAGGAAA ATACTTCCAG TCTTGATTTA
TTTTATAAGT TCAATTTTCA TTTATGGGAT GCATATTTGC TCATGTTTGA GACATACGCT GCTATTTATG GCATGTATCA
TGTGGCAACG TTGAGTTATT TATTGCAGCT TCATGGATTT TGATGCATAT TTATCAGCAG AAACTGCACA CGATGACACT
TGATTGCTTT TTTAGGATAT TGCACTCGCT GACCTGCCTA CAACTCACCC GATAAGGCTT GGACTTGCAC TGAACTTCTC
AGTGTTCTAC TATGAGATAC TGAACTCACC AGACCGTGCT TGCAACCTTG CAAAGCAGGT TAGTTTTTCA TTTTTTTCCC
TTTTGAAGTT TGTATCTTCT TGGTATCTTG TATTACTTAA TAACCTGAAT ATTTGAAACT GAAGGTGCTT GATTGCTAGT
TTTTCATGAA TAGTTATGCA TTTTTTTTAT GTAGCAAAAT TCACGTGCAA GCATAGAATT TAATTTTGTT TGGTAAATTG
AGGGAAAATA ACTGATGATT GCTTATAGTA TGCCTGTTAC TAAGTAAAGT AAATCTTCTG TCTTTGTATT CTGTTCAACC
TTAAGAATGC TGTTCACTGT GTTTTATTAT GCATTCAGAT CAGCTGTGAT GCGCCCTCTT GATTTGTTTT CAGTATGTAT
TTATCTACTC CGCTGCGTGT GTTCCATGTT TCTTCTAGTT TGTTGCATGC TTTTTCTAGT TTTTAGCACA TCACATTAAA
TTAGCTACTG CTCAAATTAA CATACTGAAC GGGCTAATCC TTCAGTTTTT CATCTAGTTA CCTCTGTGAA AAATGTTGAT
CCTGTCAATA AATTTCTGTT CATATCTGAA TTGTTTTGTC CCCTAGCTTT GATCTGGATA ATACTGCTTT TTTTAAAAAA
AATCTGAAAG ATCACCAATT AAAGCTTCGT GTCCCTTGAA ACTAGAGCTT GTTTTCTCAC TTGGTAAAGT CTGATGCCCT
CTTGTCTAGG AATATACTGA AAGATGCTAA CTTCATGTCT TTATTTTAGG CGTTCGACGA TGCTATTGCT GAACTGGACA
CTCTTGGCGA GGAGTCTTAC AAGGACAGCA CCTTGATCAT GCAACTTCTT CGTGACAATC TGACTCTCTG GACCTCTGAC
AATGCGGTAT TTGCTCTAAT ATGCTTATTA TTTTTCCTTT CATTCATTTA TACTGTAATT GTTATCAAAA CGATTTTCTG
GCATCTAATC TTATGTTCCT CTGTTCTTCT CCCTTCAGGA GGATGGTGGT GACGAGATCA AGGAAGCAGC GAAGCCTGAA
GGAGAGGGCC ACTAATCTGT CCTGAAGTCT ATTTCTGAGT CCATTTACTC AGCTACCTGC TGTATTACTG GATCATAAGA
TGTACTAGGA TCAATTGCTA TGTGGAATCA TAAGATTAGG GCTGCGTATG TCAAAATGTG TCGAGCTGAA GTACCCAGTG
GACACAGTTT ATGTGCACTA CATTGCTTCC GTGACT

Locus: Os03g0710800

Loading...

Locus: Os03g0710800

Loading...