Os03t0716200-01

Locus

Os03g0716200

Description

PHD-finger transcription factor, Regulation of Ubisch bodies and pollen wall formation

RAP-DB Gene Symbol Synonym(s)

TIP3

RAP-DB Gene Name Synonym(s)

TDR INTERACTING PROTEIN 3

CGSNL Gene Symbol

TIP3

CGSNL Gene Name

TDR INTERACTING PROTEIN 3

Oryzabase Gene Symbol Synonym(s)

OsTIP3, OsPHD12, PHD12

Oryzabase Gene Name Synonym(s)

Plant homeo-domain finger protein 12, PHD finger protein 12

Transcript Evidence

AK287630

Protein Evidence

Q8W342

Literature

PMID: 31021015

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

August 29, 2019

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, FYVE/PHD-type (IPR011011)

Zinc finger, PHD-type (IPR001965)

Zinc finger, PHD-finger (IPR019787)

Zinc finger, PHD-type, conserved site (IPR019786)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J065073I15 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0716200-01)

Others

Oryzabase (23292)

Transcript

2542 bp

>Os03t0716200-01 PHD-finger transcription factor, Regulation of Ubisch bodies and pollen wall formation
AAGGAGAGCCCAGGGCAATGCCGTCCATGCGCGCGCTCGAGCGGCTCGCCTCGTGGCCGA
CGCCCCCGCCGCCACCTCCGCCGCCGCCGCCGCCGGCGAAGGCGGCGGCGGCGGAGGCGG
AGAGGCCGTGTCCGCCGTCGTCCGCCGCCACCACCTCGTCGTCGTCTTCTTCCTCGGCCT
CGGCCGCGCCCGCGGCGGCGGGGGCGCCGCGCGTCTACCCGCTGCGGGACTTCCCGGGGA
GGGAGGCGGCGGGGCTGGGCGGCGCGTTCCGGGACAACGTGCGGTGGCTGCTGAGGCAGT
GGGGCGGCGCCTCCCCCGCCTCCCCCGCCGCCGGGGGTCCTGGGTCGGCGTCGGCGGCGG
TGGCGGTGGCGTGGCGGGTGCTCCTCTCCGACGACCGCACCGGCGTCGTCGTCCCCATCT
TCGCCGTCGAGGAGCCCGTCGCGTCCTCGCCCAAGCCGCTCTGCGATTACTGCCGCTGGG
CGGGTTGGAGCCACCATTGGGTGTCAAAGCGGAAGTACCATTTCATTATTCCGGCGCCCG
CTGACTGGGACCGCCAGCTTGCTGCTGATGTGATCCTTGGACGCACCGACCACCTCCTCC
ATGGCCTGATCCACAGCAATGGTTTTGGTCACCTTGTCATGCTCCGTGGTCGCGATGGCG
GCTCCACTGCACTATCTGGCCGTGACATCATGGACATCTGGGATTGCCTCTGCTCCGCTC
TTCGTGCCAGGGCTGTGTCTGTGGTGGACTTTTCCCAGAAACGCTCTCTGGATCTTCGTC
TCCTGCTCAGCGTGGCACATGGTGACACATGGTTCACCCGATGGGGATACTGCCTTGCAA
GGGGTTGCTTCTGTGTGTCTACCTCGACCTATGCAGCTTCCGTGGAAGCGTTGGCTGCCC
TGCCTGTGGACTATCTTCGCAGCCGTCACGTCCGCCGTGTGGTAACCATTTACCGCCGCC
TATCCAACAAACCTCTGGTTACAGTCCGTGAGTTCCTCCGCTGCCTCCTTGATTGGAAGC
ACCTTGAGCCACCCCTTCAATTACCTCCTGTGAAGACATGCACACGGCTGCAATTCATGC
TGCCAAAGCCATCTGTGATGAAGAGACACAGGCAGCAGCCATGCCAGCGCTTTGAGGATG
TGATTGACCTGCTCCAGTGTCGCTGGTCCAAGAAGCGGCTTCTTGATGCTGCAGAGGTTG
TTGTTGACAGGCTGCTAGAGCATGGCAGCGGGGCAGAGATGACACGGCAGGCGGTGCGAG
ATGCTGCAAGGGGCGCCATTGGTGATACTGGTCTCCTTGACTTTGTCATCAAGTCCCTTG
GTGATACCATTGTTGGCAACTATATTGTGCGACGTGTGCCTGATGCTGAAACACGTGTGC
TTCACTTTAGCCTTGAGGAATATGAAGAGCCAACACCAGCACTGTTGGATGTTGAGGTAG
AGTGCACACCATTGCCACCTGTGGTACGGTGGCCTAGCACAGTGGAAGTAGAGCGAGATC
TGCGTGCTGTCTACCGAGCAATGGTCGAGGTGCGCAGTGAGGCAGCACAGGCTGTGCTGG
ACTGCAAGCACTGGGTGAAGTGGTGGGGCCTTGGGGATGAGTCCGATGACCAGCTGAGGT
TTTTCGTTGAGTGGCAACCCCAGCCATGGGAAGCTGCTGAGCTTATACGGCCAATGCCAC
TGGGGGAGATTGTGGTGGTACCACTCCATGCATCCATGGGTGAGCTTCTTGTCGAGTCAG
AGCATGCGCTGCGGGACACTTACTACTTCTTTGAGGAATTCCAGGCTGAAGGGCTGCATG
GCATTGCTGGGGAGAAATGGGATCCAGTGATGCTTGGTGGGGCAGAGAATGGTGACACAA
TCAGCGTGTATGGCAATGGGGCAGACATGGAAACTGAGCTGCGGTGCCATGGTGGACTTG
ACTTGTGGGAGGTGCGGTGCGTGTGTGGTGCGCAGGATGATGATGGTGAGCGCATGATAG
CATGCGATGCTTGCGATGTATGGCACCACACACGTTGCGTGGGCATTGCAGACAGCGAGC
CTGTGCCACCATTATTTCTTTGTGTGCTCTGCGGTGGTGCGCTCATGGCGGCTGGACCGA
TCAATTCTTGAAGAGGCACTAACGCTACCTGAAAGCCAAGTGACTATTCTATTCTTTTCC
CCTTTCTTACTTCCCTTCGGTTCATATTTCCAGTGACGATAGTCTGACGAGGTAAACTTA
GTTCTGAAACTGCAACTTATGGTGTAAAGTGCGTTGTTTTGGCAGTATGTAGTAACTTCT
AATGCTGTGTAGTAAGTAGTAGATGGGAAGCGGGTTTAGACAGTAGACTTGGGGAAGCCC
TATCCATGTCGTTAGCAATTCGACTGGAAATTTTGTACCTGATACACTACAGAAGATGAT
ATAGCTAGATGTAAATACATGTTCTGTGATTGTATCTTTTACGGCCTCCCAGTCCCAATT
GGTGAAGCTATACAGTGTAATTTTTTGTGCTAGGTATACAATGTAATTTAGCATCAGCAA
TGACAAAACTGTATCTTTCTTC

CDS

2094 bp

>Os03t0716200-01 PHD-finger transcription factor, Regulation of Ubisch bodies and pollen wall formation
ATGCCGTCCATGCGCGCGCTCGAGCGGCTCGCCTCGTGGCCGACGCCCCCGCCGCCACCT
CCGCCGCCGCCGCCGCCGGCGAAGGCGGCGGCGGCGGAGGCGGAGAGGCCGTGTCCGCCG
TCGTCCGCCGCCACCACCTCGTCGTCGTCTTCTTCCTCGGCCTCGGCCGCGCCCGCGGCG
GCGGGGGCGCCGCGCGTCTACCCGCTGCGGGACTTCCCGGGGAGGGAGGCGGCGGGGCTG
GGCGGCGCGTTCCGGGACAACGTGCGGTGGCTGCTGAGGCAGTGGGGCGGCGCCTCCCCC
GCCTCCCCCGCCGCCGGGGGTCCTGGGTCGGCGTCGGCGGCGGTGGCGGTGGCGTGGCGG
GTGCTCCTCTCCGACGACCGCACCGGCGTCGTCGTCCCCATCTTCGCCGTCGAGGAGCCC
GTCGCGTCCTCGCCCAAGCCGCTCTGCGATTACTGCCGCTGGGCGGGTTGGAGCCACCAT
TGGGTGTCAAAGCGGAAGTACCATTTCATTATTCCGGCGCCCGCTGACTGGGACCGCCAG
CTTGCTGCTGATGTGATCCTTGGACGCACCGACCACCTCCTCCATGGCCTGATCCACAGC
AATGGTTTTGGTCACCTTGTCATGCTCCGTGGTCGCGATGGCGGCTCCACTGCACTATCT
GGCCGTGACATCATGGACATCTGGGATTGCCTCTGCTCCGCTCTTCGTGCCAGGGCTGTG
TCTGTGGTGGACTTTTCCCAGAAACGCTCTCTGGATCTTCGTCTCCTGCTCAGCGTGGCA
CATGGTGACACATGGTTCACCCGATGGGGATACTGCCTTGCAAGGGGTTGCTTCTGTGTG
TCTACCTCGACCTATGCAGCTTCCGTGGAAGCGTTGGCTGCCCTGCCTGTGGACTATCTT
CGCAGCCGTCACGTCCGCCGTGTGGTAACCATTTACCGCCGCCTATCCAACAAACCTCTG
GTTACAGTCCGTGAGTTCCTCCGCTGCCTCCTTGATTGGAAGCACCTTGAGCCACCCCTT
CAATTACCTCCTGTGAAGACATGCACACGGCTGCAATTCATGCTGCCAAAGCCATCTGTG
ATGAAGAGACACAGGCAGCAGCCATGCCAGCGCTTTGAGGATGTGATTGACCTGCTCCAG
TGTCGCTGGTCCAAGAAGCGGCTTCTTGATGCTGCAGAGGTTGTTGTTGACAGGCTGCTA
GAGCATGGCAGCGGGGCAGAGATGACACGGCAGGCGGTGCGAGATGCTGCAAGGGGCGCC
ATTGGTGATACTGGTCTCCTTGACTTTGTCATCAAGTCCCTTGGTGATACCATTGTTGGC
AACTATATTGTGCGACGTGTGCCTGATGCTGAAACACGTGTGCTTCACTTTAGCCTTGAG
GAATATGAAGAGCCAACACCAGCACTGTTGGATGTTGAGGTAGAGTGCACACCATTGCCA
CCTGTGGTACGGTGGCCTAGCACAGTGGAAGTAGAGCGAGATCTGCGTGCTGTCTACCGA
GCAATGGTCGAGGTGCGCAGTGAGGCAGCACAGGCTGTGCTGGACTGCAAGCACTGGGTG
AAGTGGTGGGGCCTTGGGGATGAGTCCGATGACCAGCTGAGGTTTTTCGTTGAGTGGCAA
CCCCAGCCATGGGAAGCTGCTGAGCTTATACGGCCAATGCCACTGGGGGAGATTGTGGTG
GTACCACTCCATGCATCCATGGGTGAGCTTCTTGTCGAGTCAGAGCATGCGCTGCGGGAC
ACTTACTACTTCTTTGAGGAATTCCAGGCTGAAGGGCTGCATGGCATTGCTGGGGAGAAA
TGGGATCCAGTGATGCTTGGTGGGGCAGAGAATGGTGACACAATCAGCGTGTATGGCAAT
GGGGCAGACATGGAAACTGAGCTGCGGTGCCATGGTGGACTTGACTTGTGGGAGGTGCGG
TGCGTGTGTGGTGCGCAGGATGATGATGGTGAGCGCATGATAGCATGCGATGCTTGCGAT
GTATGGCACCACACACGTTGCGTGGGCATTGCAGACAGCGAGCCTGTGCCACCATTATTT
CTTTGTGTGCTCTGCGGTGGTGCGCTCATGGCGGCTGGACCGATCAATTCTTGA

Protein

698 aa

>Os03t0716200-01 PHD-finger transcription factor, Regulation of Ubisch bodies and pollen wall formation
MPSMRALERLASWPTPPPPPPPPPPPAKAAAAEAERPCPPSSAATTSSSSSSSASAAPAA
AGAPRVYPLRDFPGREAAGLGGAFRDNVRWLLRQWGGASPASPAAGGPGSASAAVAVAWR
VLLSDDRTGVVVPIFAVEEPVASSPKPLCDYCRWAGWSHHWVSKRKYHFIIPAPADWDRQ
LAADVILGRTDHLLHGLIHSNGFGHLVMLRGRDGGSTALSGRDIMDIWDCLCSALRARAV
SVVDFSQKRSLDLRLLLSVAHGDTWFTRWGYCLARGCFCVSTSTYAASVEALAALPVDYL
RSRHVRRVVTIYRRLSNKPLVTVREFLRCLLDWKHLEPPLQLPPVKTCTRLQFMLPKPSV
MKRHRQQPCQRFEDVIDLLQCRWSKKRLLDAAEVVVDRLLEHGSGAEMTRQAVRDAARGA
IGDTGLLDFVIKSLGDTIVGNYIVRRVPDAETRVLHFSLEEYEEPTPALLDVEVECTPLP
PVVRWPSTVEVERDLRAVYRAMVEVRSEAAQAVLDCKHWVKWWGLGDESDDQLRFFVEWQ
PQPWEAAELIRPMPLGEIVVVPLHASMGELLVESEHALRDTYYFFEEFQAEGLHGIAGEK
WDPVMLGGAENGDTISVYGNGADMETELRCHGGLDLWEVRCVCGAQDDDGERMIACDACD
VWHHTRCVGIADSEPVPPLFLCVLCGGALMAAGPINS*

5'UTR

chr03:28991846..28991862 (- strand) : 17 bp

CDS

chr03:28991380..28991845 (- strand) : 466 bp

chr03:28990501..28990747 (- strand) : 247 bp

chr03:28988840..28990220 (- strand) : 1381 bp

3'UTR

chr03:28988409..28988839 (- strand) : 431 bp

FASTA

>Os03t0716200-01 class=Sequence position=chr03:28988409..28991862 (- strand)
AAGGAGAGCC CAGGGCAATG CCGTCCATGC GCGCGCTCGA GCGGCTCGCC TCGTGGCCGA CGCCCCCGCC GCCACCTCCG
CCGCCGCCGC CGCCGGCGAA GGCGGCGGCG GCGGAGGCGG AGAGGCCGTG TCCGCCGTCG TCCGCCGCCA CCACCTCGTC
GTCGTCTTCT TCCTCGGCCT CGGCCGCGCC CGCGGCGGCG GGGGCGCCGC GCGTCTACCC GCTGCGGGAC TTCCCGGGGA
GGGAGGCGGC GGGGCTGGGC GGCGCGTTCC GGGACAACGT GCGGTGGCTG CTGAGGCAGT GGGGCGGCGC CTCCCCCGCC
TCCCCCGCCG CCGGGGGTCC TGGGTCGGCG TCGGCGGCGG TGGCGGTGGC GTGGCGGGTG CTCCTCTCCG ACGACCGCAC
CGGCGTCGTC GTCCCCATCT TCGCCGTCGA GGAGCCCGTC GCGTCCTCGC CCAAGCCGCT CTGCGATTAC TGCCGCTGGG
CGGGTGAGTT TCCCTCCTCC TCCATATGGC TCCTCGCGTG CTTGGCCGTG CGCGCCGCGC CTTCCCCTTT CGAAATGGGT
GGGAGTTGAC GGGTGCGGAG ATTAGGTTTT CCCCCCAATC CTTTTCTTGT TGATTAGAGT TGATTTGGGC GAATTGATGA
GTAGTACTCC GTATTGTTCT TGCAAATGAT ATTTTCATCG TGGTTTGAGG AAATGCGCGG GTTTGTGATC CTAGAGATTT
CTTTGGACGA CTTTGAGACG GTCATCTTCT TCCAAATTGC AAATTTCTTG GTGAATAACG TTCCAGAATC GCGCCCTCGA
TTGAGCACTT ACTAGTTAGC AACTTTTGAT TCCGTTGATG AAATGGATCG TAATAACTGA ATTCTGTTAC TGTACTTGAA
TCGATGATCA TTGGAACTTT TTTTTTCTGT ACTCCTTTAC CTGGATTTGG TGTGTCTATT TCAATTATTT TTTGAATCCG
TTTCCTAAAA CAGCAATGCT AGTTGTAATG ATGGCCTCTG GCCTCTTAAA GTTTATTGCT TCTATTGGAA AATTGGTAGT
TTGGGCATTG ATTTGGGTTG GTTCCTGGTT CTTTGAACCA GTACTAACAA ATACGTGCTA TACTAATGGT GTCAGGTTGG
AGCCACCATT GGGTGTCAAA GCGGAAGTAC CATTTCATTA TTCCGGCGCC CGCTGACTGG GACCGCCAGC TTGCTGCTGA
TGTGATCCTT GGACGCACCG ACCACCTCCT CCATGGCCTG ATCCACAGCA ATGGTTTTGG TCACCTTGTC ATGCTCCGTG
GTCGCGATGG CGGCTCCACT GCACTATCTG GCCGTGACAT CATGGACATC TGGGATTGCC TCTGCTCCGC TCTTCGTGCC
AGGTAGCTTC AGATTGTTTT CTGCCTGATC GTTAGTTCTC TGCACATGCT TCTGTTATCA TGACTGAAGA ATTAGTTAGC
TCATGTTATG TAAACGCCTG TACGGAAAGG GGCTTAGTGT AAAACTTCCA TGGCACAACT TAGGAGGTAA GGAGGATAAG
TTATAGAAGT TCATAACTTT TGCATGTATT CTTGGTGATC CTAAATTATG ATAAGCACGC AAAGGTTATT ATATCATGAT
GATTACTACT TCATCTATTG AGCTTGAGAA CCTTCTGTGC AGGGCTGTGT CTGTGGTGGA CTTTTCCCAG AAACGCTCTC
TGGATCTTCG TCTCCTGCTC AGCGTGGCAC ATGGTGACAC ATGGTTCACC CGATGGGGAT ACTGCCTTGC AAGGGGTTGC
TTCTGTGTGT CTACCTCGAC CTATGCAGCT TCCGTGGAAG CGTTGGCTGC CCTGCCTGTG GACTATCTTC GCAGCCGTCA
CGTCCGCCGT GTGGTAACCA TTTACCGCCG CCTATCCAAC AAACCTCTGG TTACAGTCCG TGAGTTCCTC CGCTGCCTCC
TTGATTGGAA GCACCTTGAG CCACCCCTTC AATTACCTCC TGTGAAGACA TGCACACGGC TGCAATTCAT GCTGCCAAAG
CCATCTGTGA TGAAGAGACA CAGGCAGCAG CCATGCCAGC GCTTTGAGGA TGTGATTGAC CTGCTCCAGT GTCGCTGGTC
CAAGAAGCGG CTTCTTGATG CTGCAGAGGT TGTTGTTGAC AGGCTGCTAG AGCATGGCAG CGGGGCAGAG ATGACACGGC
AGGCGGTGCG AGATGCTGCA AGGGGCGCCA TTGGTGATAC TGGTCTCCTT GACTTTGTCA TCAAGTCCCT TGGTGATACC
ATTGTTGGCA ACTATATTGT GCGACGTGTG CCTGATGCTG AAACACGTGT GCTTCACTTT AGCCTTGAGG AATATGAAGA
GCCAACACCA GCACTGTTGG ATGTTGAGGT AGAGTGCACA CCATTGCCAC CTGTGGTACG GTGGCCTAGC ACAGTGGAAG
TAGAGCGAGA TCTGCGTGCT GTCTACCGAG CAATGGTCGA GGTGCGCAGT GAGGCAGCAC AGGCTGTGCT GGACTGCAAG
CACTGGGTGA AGTGGTGGGG CCTTGGGGAT GAGTCCGATG ACCAGCTGAG GTTTTTCGTT GAGTGGCAAC CCCAGCCATG
GGAAGCTGCT GAGCTTATAC GGCCAATGCC ACTGGGGGAG ATTGTGGTGG TACCACTCCA TGCATCCATG GGTGAGCTTC
TTGTCGAGTC AGAGCATGCG CTGCGGGACA CTTACTACTT CTTTGAGGAA TTCCAGGCTG AAGGGCTGCA TGGCATTGCT
GGGGAGAAAT GGGATCCAGT GATGCTTGGT GGGGCAGAGA ATGGTGACAC AATCAGCGTG TATGGCAATG GGGCAGACAT
GGAAACTGAG CTGCGGTGCC ATGGTGGACT TGACTTGTGG GAGGTGCGGT GCGTGTGTGG TGCGCAGGAT GATGATGGTG
AGCGCATGAT AGCATGCGAT GCTTGCGATG TATGGCACCA CACACGTTGC GTGGGCATTG CAGACAGCGA GCCTGTGCCA
CCATTATTTC TTTGTGTGCT CTGCGGTGGT GCGCTCATGG CGGCTGGACC GATCAATTCT TGAAGAGGCA CTAACGCTAC
CTGAAAGCCA AGTGACTATT CTATTCTTTT CCCCTTTCTT ACTTCCCTTC GGTTCATATT TCCAGTGACG ATAGTCTGAC
GAGGTAAACT TAGTTCTGAA ACTGCAACTT ATGGTGTAAA GTGCGTTGTT TTGGCAGTAT GTAGTAACTT CTAATGCTGT
GTAGTAAGTA GTAGATGGGA AGCGGGTTTA GACAGTAGAC TTGGGGAAGC CCTATCCATG TCGTTAGCAA TTCGACTGGA
AATTTTGTAC CTGATACACT ACAGAAGATG ATATAGCTAG ATGTAAATAC ATGTTCTGTG ATTGTATCTT TTACGGCCTC
CCAGTCCCAA TTGGTGAAGC TATACAGTGT AATTTTTTGT GCTAGGTATA CAATGTAATT TAGCATCAGC AATGACAAAA
CTGTATCTTT CTTC

Locus: Os03g0716200

Loading...

Locus: Os03g0716200

Loading...