Os03t0721900-00

Locus

Os03g0721900

Description

Similar to Histone H2A.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

EU958597 (DDBJ)

Protein Evidence

B6T543 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: nucleosome assembly (GO:0006334)

Cellular Component: nucleosome (GO:0000786)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Histone H2A (IPR002119)

Histone core (IPR007125)

Histone-fold (IPR009072)

Expression Databases

TENOR (Os03t0721900-00)

Transcript

471 bp

>Os03t0721900-00 Similar to Histone H2A.
CACTATAAAACCGCGGCGCCGCCCGCCTCTCCCCTCCACCGCCTCTCTCCACTCTCTCTC
TCTCTCTCTCTCTCTCTCTCTCTCCAATCTCGAAGAGTTCCAGAAGCTTCCAACCTTCGG
CGGCGAGATGAGTTCCTCTCAGGGAGGCGGCGGCCGCGGCAAGGCGAAGACGACGAAGGC
GGTGTCGCGGTCGTCCAAGGCCGGGCTCCAGTTccccgtcggccgcatcgcccgctacct
caaggccggcaaGTGCTGGAGCTGGCCGGGAACGCGGCGAGGGACAACAAGAAGAACAGG
ATCGTGCCGCGGCACATCCAGCTGGCGGTGCGCAACGACGAGGAGCTGAGCAGGCTGCTG
GGCACCGTCACGATCGCCGCCGGCGGCGTGCTGCCCAACATCCAGCAGGTCCTGCTTCCC
AAGAAGGGCGGCGGCAAGGGCGACATCGGCTCCGCCTCCCAGGAGTTTTGA

CDS

471 bp

>Os03t0721900-00 Similar to Histone H2A.
CACTATAAAACCGCGGCGCCGCCCGCCTCTCCCCTCCACCGCCTCTCTCCACTCTCTCTC
TCTCTCTCTCTCTCTCTCTCTCTCCAATCTCGAAGAGTTCCAGAAGCTTCCAACCTTCGG
CGGCGAGATGAGTTCCTCTCAGGGAGGCGGCGGCCGCGGCAAGGCGAAGACGACGAAGGC
GGTGTCGCGGTCGTCCAAGGCCGGGCTCCAGTTccccgtcggccgcatcgcccgctacct
caaggccggcaaGTGCTGGAGCTGGCCGGGAACGCGGCGAGGGACAACAAGAAGAACAGG
ATCGTGCCGCGGCACATCCAGCTGGCGGTGCGCAACGACGAGGAGCTGAGCAGGCTGCTG
GGCACCGTCACGATCGCCGCCGGCGGCGTGCTGCCCAACATCCAGCAGGTCCTGCTTCCC
AAGAAGGGCGGCGGCAAGGGCGACATCGGCTCCGCCTCCCAGGAGTTTTGA

Protein

156 aa

>Os03t0721900-00 Similar to Histone H2A.
HYKTAAPPASPLHRLSPLSLSLSLSLSLQSRRVPEASNLRRRDEFLSGRRRPRQGEDDEG
GVAVVQGRAPVPRRPHRPLPQGRQVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSRLL
GTVTIAAGGVLPNIQQVLLPKKGGGKGDIGSASQEF*

CDS

chr03:29291384..29291635 (+ strand) : 252 bp

chr03:29291810..29292028 (+ strand) : 219 bp

FASTA

>Os03t0721900-00 class=Sequence position=chr03:29291384..29292028 (+ strand)
CACTATAAAA CCGCGGCGCC GCCCGCCTCT CCCCTCCACC GCCTCTCTCC ACTCTCTCTC TCTCTCTCTC TCTCTCTCTC
TCTCCAATCT CGAAGAGTTC CAGAAGCTTC CAACCTTCGG CGGCGAGATG AGTTCCTCTC AGGGAGGCGG CGGCCGCGGC
AAGGCGAAGA CGACGAAGGC GGTGTCGCGG TCGTCCAAGG CCGGGCTCCA GTTccccgtc ggccgcatcg cccgctacct
caaggccggc aagtacgcgg agcgcgtcgg cgccggcgcc cccgtctacc tctccgccgt cctcgagtac ctcgccgccg
aggtaaaccC CATCCCTTCC CCTCCCGCTC GATCCGCGTG GGATCTTCCG ATCTCGTGTC CCCCGAATCG TGTGTTCTGA
TCACCCATTG GCTGTGTTAA TCGCAGGTGC TGGAGCTGGC CGGGAACGCG GCGAGGGACA ACAAGAAGAA CAGGATCGTG
CCGCGGCACA TCCAGCTGGC GGTGCGCAAC GACGAGGAGC TGAGCAGGCT GCTGGGCACC GTCACGATCG CCGCCGGCGG
CGTGCTGCCC AACATCCAGC AGGTCCTGCT TCCCAAGAAG GGCGGCGGCA AGGGCGACAT CGGCTCCGCC TCCCAGGAGT
TTTGA

Locus: Os03g0721900

Loading...

Locus: Os03g0721900

Loading...