Os03t0727600-01

Locus

Os03g0727600

Description

ACC synthase, Ethylene biosynthesis

RAP-DB Gene Symbol Synonym(s)

ACS1, ACC1*, OsACS1, Os-ACS1, ACC1

RAP-DB Gene Name Synonym(s)

ACC SYNTHASE 1, 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 1, ACC synthase 1, 1-aminocyclopropane-1-carboxylate synthase 1, ACC synthase-1, S-adenosyl-L-methionine methylthioadenosine-lyase 1

CGSNL Gene Symbol

ACS1

CGSNL Gene Name

ACC SYNTHASE 1

Oryzabase Gene Symbol Synonym(s)

ACC1*, OsACS1, Os-ACS1, ACC1

Oryzabase Gene Name Synonym(s)

1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 1, ACC synthase 1, 1-aminocyclopropane-1-carboxylate synthase 1, ACC synthase-1, S-adenosyl-L-methionine methylthioadenosine-lyase 1, 1-aminocyclopropane-1-carboxylic acid synthase 1

Transcript Evidence

AK071011

Protein Evidence

Q10DK7

B7EIR0

Literature

PMID: 17012402

Note

Manual Curation

November 17, 2009

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

Functional domain (InterPro)

Pyridoxal phosphate-dependent transferase (IPR015424)

Aminotransferase, class I/classII (IPR004839)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (IPR015422)

Aminotransferases, class-I, pyridoxal-phosphate-binding site (IPR004838)

Full-length cDNA

J023080J16 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0727600-01)

RiceXPro (AK071011)

Others

Oryzabase (518)

KEGG (Os03t0727600-01 (EC:4.4.1.14))

Transcript

1970 bp

>Os03t0727600-01 ACC synthase, Ethylene biosynthesis
GCAGCAGCCAGCTAGCTAGCTACTCCTACTCAGCAGCAGCAGCAGCTCAGGTCTCTCCAG
TGTTCTTCGAGCTATACACTAGCTCTCACAGATTTTTGCTCCGACTCATCAAGCGGATTG
ATTCGATCGGCTGTTAGAGAGAGAAAAAAGGAGAGTTGGAGATGGTGAGCCAAGTGGTCG
CCGAGGAGAAGCCGCAGCTGCTGTCCAAGAAGGCCGGGTGCAACAGCCACGGCCAGGACT
CGTCCTACTTCCTGGGGTGGCAGGAGTACGAGAAAAACCCGTTCGACCCCGTCTCCAACC
CTTCCGGCATCATCCAGATGGGCCTCGCCGAGAACCAGCTGTCGTTCGACCTGCTTGAGG
AGTGGCTGGAGAAGAACCCCCACGCGCTCGGCCTCCGGCGAGAGGGCGGCGGCGCCTCCG
TCTTCCGCGAGCTCGCGCTGTTCCAGGACTACCACGGCCTCCCGGCTTTCAAAAATGCAT
TGGCGCGGTTCATGTCGGAGCAGAGAGGGTACAAGGTGGTGTTCGACCCCAGCAACATCG
TGCTCACcgccggcgccacctcggctaacgaggcgctcatgttctgcctcgccgaccacg
gcgacgccttccTCATCCCCACCCCATACTACCCAGGGTTCGACCGCGACCTCAAGTGGC
GCACCGGCGCGGAGATCGTACCCGTGCACTGCGCGAGCGCGAACGGGTTCCGGGTGACGC
GCCCCGCGCTGGACGACGCGTACCGCCGCGCGCAGAAGCGCCGGCTGCGCGTCAAGGGGG
TGCTGATCACCAACCCGTCCAACCCGCTCGGCACCGCGTCGCCGCGCGCCGACCTCGAGA
CGATCGTCGACTTCGTCGCCGCCAAGGGCATCCACCTCATCAGCGACGAGATCTACGCCG
GCACGGCGTTCGCCGAGCCGCCCGCGGGCTTCGTCAGCGCGCTCGAGGTCGTGGCCGGGC
GCGACGGCGGCGGCGCTGACGTGTCCGACCGCGTGCACGTCGTGTACAGCCTGTCCAAGG
ACCTCGGCCTCCCGGGGTTCCGCGTCGGCGCCATCTACTCCGCCAACGCCGCCGTCGTGT
CCGCGGCGACCAAGATGTCCAGCTTCGGCCTCGTGTCGTCCCAGACGCAGTACCTCCTCG
CGGCGCTGCTCGGCGACAGGGACTTCACCCGGAGCTACGTCGCGGAGAACAAGCGGCGGA
TCAAGGAGCGGCACGACCAGCTCGTGGACGGGCTCAGGGAGATCGGCATTGGGTGCCTGC
CCAGCAACGCCGGCCTCTTCTGCTGGGTGGACATGAGCCACCTGATGCGGAGCCGGTCGT
TCGCCGGCGAGATGGAGCTCTGGAAGAAGGTGGTGTTCGAGGTCGGCCTCAACATCTCCC
CCGGGTCGTCGTGCCACTGCCGCGAGCCCGGCTGGTTCCGCGTCTGCTTCGCCAACATGT
CGGCCAAGACCCTCGACGTCGCCATGCAGCGCCTCAGGTCGTTCGTCGACTCCGCCACCG
GCGGCGGCGACAACGCCGCCCTCCGCCGCGCCGCCGTCCCCGTCAGGAGCGTCAGCTGCC
CGCTCGCCATCAAGTGGGCGCTCCGCCTCACCCCGTCCATCGCCGACCGGAAGGCCGAGA
GATAATCGCCAAGAACAAAACCACACCATGTCCATTACTATTACCAGTAGTAGCACATAC
TAGTACATTACTACGTCACAGTACACTATACTAGTAGCAGCAGTAGCAGATTCCTTTCGT
TTCTTGTAATCTTTTGGCGCCATTTTTTTTTCCTCGGATCGAGGCGTGCATGCCCGATGG
TCTCGGATGATCACATATCGATCCATTCCATCAGCCGGCATCGGATCGATCCCGTATTTT
TCACTGGGAATTTTCAGTTTTCCCCCGACACTGAATTTCTCCCAGTTGTTGTAACCTATG
GAAAGTATTATTGCTCGTCAATAAAAGCTAGTGCCCACCACTTGTAGTTC

CDS

1464 bp

>Os03t0727600-01 ACC synthase, Ethylene biosynthesis
ATGGTGAGCCAAGTGGTCGCCGAGGAGAAGCCGCAGCTGCTGTCCAAGAAGGCCGGGTGC
AACAGCCACGGCCAGGACTCGTCCTACTTCCTGGGGTGGCAGGAGTACGAGAAAAACCCG
TTCGACCCCGTCTCCAACCCTTCCGGCATCATCCAGATGGGCCTCGCCGAGAACCAGCTG
TCGTTCGACCTGCTTGAGGAGTGGCTGGAGAAGAACCCCCACGCGCTCGGCCTCCGGCGA
GAGGGCGGCGGCGCCTCCGTCTTCCGCGAGCTCGCGCTGTTCCAGGACTACCACGGCCTC
CCGGCTTTCAAAAATGCATTGGCGCGGTTCATGTCGGAGCAGAGAGGGTACAAGGTGGTG
TTCGACCCCAGCAACATCGTGCTCACcgccggcgccacctcggctaacgaggcgctcatg
ttctgcctcgccgaccacggcgacgccttccTCATCCCCACCCCATACTACCCAGGGTTC
GACCGCGACCTCAAGTGGCGCACCGGCGCGGAGATCGTACCCGTGCACTGCGCGAGCGCG
AACGGGTTCCGGGTGACGCGCCCCGCGCTGGACGACGCGTACCGCCGCGCGCAGAAGCGC
CGGCTGCGCGTCAAGGGGGTGCTGATCACCAACCCGTCCAACCCGCTCGGCACCGCGTCG
CCGCGCGCCGACCTCGAGACGATCGTCGACTTCGTCGCCGCCAAGGGCATCCACCTCATC
AGCGACGAGATCTACGCCGGCACGGCGTTCGCCGAGCCGCCCGCGGGCTTCGTCAGCGCG
CTCGAGGTCGTGGCCGGGCGCGACGGCGGCGGCGCTGACGTGTCCGACCGCGTGCACGTC
GTGTACAGCCTGTCCAAGGACCTCGGCCTCCCGGGGTTCCGCGTCGGCGCCATCTACTCC
GCCAACGCCGCCGTCGTGTCCGCGGCGACCAAGATGTCCAGCTTCGGCCTCGTGTCGTCC
CAGACGCAGTACCTCCTCGCGGCGCTGCTCGGCGACAGGGACTTCACCCGGAGCTACGTC
GCGGAGAACAAGCGGCGGATCAAGGAGCGGCACGACCAGCTCGTGGACGGGCTCAGGGAG
ATCGGCATTGGGTGCCTGCCCAGCAACGCCGGCCTCTTCTGCTGGGTGGACATGAGCCAC
CTGATGCGGAGCCGGTCGTTCGCCGGCGAGATGGAGCTCTGGAAGAAGGTGGTGTTCGAG
GTCGGCCTCAACATCTCCCCCGGGTCGTCGTGCCACTGCCGCGAGCCCGGCTGGTTCCGC
GTCTGCTTCGCCAACATGTCGGCCAAGACCCTCGACGTCGCCATGCAGCGCCTCAGGTCG
TTCGTCGACTCCGCCACCGGCGGCGGCGACAACGCCGCCCTCCGCCGCGCCGCCGTCCCC
GTCAGGAGCGTCAGCTGCCCGCTCGCCATCAAGTGGGCGCTCCGCCTCACCCCGTCCATC
GCCGACCGGAAGGCCGAGAGATAA

Protein

488 aa

>Os03t0727600-01 ACC synthase, Ethylene biosynthesis
MVSQVVAEEKPQLLSKKAGCNSHGQDSSYFLGWQEYEKNPFDPVSNPSGIIQMGLAENQL
SFDLLEEWLEKNPHALGLRREGGGASVFRELALFQDYHGLPAFKNALARFMSEQRGYKVV
FDPSNIVLTAGATSANEALMFCLADHGDAFLIPTPYYPGFDRDLKWRTGAEIVPVHCASA
NGFRVTRPALDDAYRRAQKRRLRVKGVLITNPSNPLGTASPRADLETIVDFVAAKGIHLI
SDEIYAGTAFAEPPAGFVSALEVVAGRDGGGADVSDRVHVVYSLSKDLGLPGFRVGAIYS
ANAAVVSAATKMSSFGLVSSQTQYLLAALLGDRDFTRSYVAENKRRIKERHDQLVDGLRE
IGIGCLPSNAGLFCWVDMSHLMRSRSFAGEMELWKKVVFEVGLNISPGSSCHCREPGWFR
VCFANMSAKTLDVAMQRLRSFVDSATGGGDNAALRRAAVPVRSVSCPLAIKWALRLTPSI
ADRKAER*

5'UTR

chr03:29662762..29662922 (- strand) : 161 bp

CDS

chr03:29662585..29662761 (- strand) : 177 bp

chr03:29662352..29662489 (- strand) : 138 bp

chr03:29662093..29662253 (- strand) : 161 bp

chr03:29661007..29661994 (- strand) : 988 bp

3'UTR

chr03:29660662..29661006 (- strand) : 345 bp

FASTA

>Os03t0727600-01 class=Sequence position=chr03:29660662..29662922 (- strand)
GCAGCAGCCA GCTAGCTAGC TACTCCTACT CAGCAGCAGC AGCAGCTCAG GTCTCTCCAG TGTTCTTCGA GCTATACACT
AGCTCTCACA GATTTTTGCT CCGACTCATC AAGCGGATTG ATTCGATCGG CTGTTAGAGA GAGAAAAAAG GAGAGTTGGA
GATGGTGAGC CAAGTGGTCG CCGAGGAGAA GCCGCAGCTG CTGTCCAAGA AGGCCGGGTG CAACAGCCAC GGCCAGGACT
CGTCCTACTT CCTGGGGTGG CAGGAGTACG AGAAAAACCC GTTCGACCCC GTCTCCAACC CTTCCGGCAT CATCCAGATG
GGCCTCGCCG AGAACCAGGT ACGCACACGC GCGTGCCACA CCTGCATGTA CACACTTGTA CATGTGTGTA CACTGTCTCT
GACGACATGG TTGCTCTGCC TTGGCTGTTG CAGCTGTCGT TCGACCTGCT TGAGGAGTGG CTGGAGAAGA ACCCCCACGC
GCTCGGCCTC CGGCGAGAGG GCGGCGGCGC CTCCGTCTTC CGCGAGCTCG CGCTGTTCCA GGACTACCAC GGCCTCCCGG
CTTTCAAAAA TGTAATTAAT TAAATCAACT GTACTCTGGT TCGCGTACAC GGTCGTCAAA AGTTACAGTT GGCTAACCCC
CCGAGCATAT GCGCACGTGG ATTGCACAGG CATTGGCGCG GTTCATGTCG GAGCAGAGAG GGTACAAGGT GGTGTTCGAC
CCCAGCAACA TCGTGCTCAC cgccggcgcc acctcggcta acgaggcgct catgttctgc ctcgccgacc acggcgacgc
cttccTCATC CCCACCCCAT ACTACCCAGG GTACGCACTG GCACTGCCGC TGCTGCTACA CCTTTTTACC ATACGCGACA
ACGTGCATGG TGGCGCATGG CTAACGGTGG ATGGATGGGT GGATGCAGGT TCGACCGCGA CCTCAAGTGG CGCACCGGCG
CGGAGATCGT ACCCGTGCAC TGCGCGAGCG CGAACGGGTT CCGGGTGACG CGCCCCGCGC TGGACGACGC GTACCGCCGC
GCGCAGAAGC GCCGGCTGCG CGTCAAGGGG GTGCTGATCA CCAACCCGTC CAACCCGCTC GGCACCGCGT CGCCGCGCGC
CGACCTCGAG ACGATCGTCG ACTTCGTCGC CGCCAAGGGC ATCCACCTCA TCAGCGACGA GATCTACGCC GGCACGGCGT
TCGCCGAGCC GCCCGCGGGC TTCGTCAGCG CGCTCGAGGT CGTGGCCGGG CGCGACGGCG GCGGCGCTGA CGTGTCCGAC
CGCGTGCACG TCGTGTACAG CCTGTCCAAG GACCTCGGCC TCCCGGGGTT CCGCGTCGGC GCCATCTACT CCGCCAACGC
CGCCGTCGTG TCCGCGGCGA CCAAGATGTC CAGCTTCGGC CTCGTGTCGT CCCAGACGCA GTACCTCCTC GCGGCGCTGC
TCGGCGACAG GGACTTCACC CGGAGCTACG TCGCGGAGAA CAAGCGGCGG ATCAAGGAGC GGCACGACCA GCTCGTGGAC
GGGCTCAGGG AGATCGGCAT TGGGTGCCTG CCCAGCAACG CCGGCCTCTT CTGCTGGGTG GACATGAGCC ACCTGATGCG
GAGCCGGTCG TTCGCCGGCG AGATGGAGCT CTGGAAGAAG GTGGTGTTCG AGGTCGGCCT CAACATCTCC CCCGGGTCGT
CGTGCCACTG CCGCGAGCCC GGCTGGTTCC GCGTCTGCTT CGCCAACATG TCGGCCAAGA CCCTCGACGT CGCCATGCAG
CGCCTCAGGT CGTTCGTCGA CTCCGCCACC GGCGGCGGCG ACAACGCCGC CCTCCGCCGC GCCGCCGTCC CCGTCAGGAG
CGTCAGCTGC CCGCTCGCCA TCAAGTGGGC GCTCCGCCTC ACCCCGTCCA TCGCCGACCG GAAGGCCGAG AGATAATCGC
CAAGAACAAA ACCACACCAT GTCCATTACT ATTACCAGTA GTAGCACATA CTAGTACATT ACTACGTCAC AGTACACTAT
ACTAGTAGCA GCAGTAGCAG ATTCCTTTCG TTTCTTGTAA TCTTTTGGCG CCATTTTTTT TTCCTCGGAT CGAGGCGTGC
ATGCCCGATG GTCTCGGATG ATCACATATC GATCCATTCC ATCAGCCGGC ATCGGATCGA TCCCGTATTT TTCACTGGGA
ATTTTCAGTT TTCCCCCGAC ACTGAATTTC TCCCAGTTGT TGTAACCTAT GGAAAGTATT ATTGCTCGTC AATAAAAGCT
AGTGCCCACC ACTTGTAGTT C

Locus: Os03g0727600

Loading...

Locus: Os03g0727600

Loading...