Os03t0729500-01

Locus

Os03g0729500

Description

Transcription factor, Floral organ development

RAP-DB Gene Symbol Synonym(s)

GRF6, OsGRF6

RAP-DB Gene Name Synonym(s)

GROWTH-REGULATING FACTOR 6, growth-regulating factor6

CGSNL Gene Symbol

GRF6

CGSNL Gene Name

GROWTH-REGULATING FACTOR 6

Oryzabase Gene Symbol Synonym(s)

OsGRF6

Oryzabase Gene Name Synonym(s)

growth-regulating factor6, GROWTH REGULATING FACTOR 6

Transcript Evidence

AK073578

Protein Evidence

Inferred from literature

Literature

PMID: 24596329

PMID: 15295073

Note

Manual Curation

June 16, 2014

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides (GO:0016818)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Glutamine-Leucine-Glutamine, QLQ (IPR014978)

WRC (IPR014977)

Full-length cDNA

J033048N01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0729500-01)

Others

Oryzabase (10280)

KEGG (Os03t0729500-01)

Transcript

1809 bp

>Os03t0729500-01 Transcription factor, Floral organ development
GTTGGCTTGCACTGCCTAGCTTGTTGCTCATCTCCTTGGTGTATCTGGCTGCAGGATTGA
GCTCAGTGAGCTTGagcagcagcatgcagggtgcaatggccagggtgaggggtcccttca
cgccgtctcagtggatcgagctggagcaccaggcgctgatatacaagtacttggctgcga
atagccctgtaccacacagcctcctcatccccatcaggaggagcctcacatcgccctact
cacctgccTACTTTGGCTCAAGCACATTGGGATGGGGATCTTTCCAGCtgggctactccg
gcagcgcggatccggagcccggccggtgccgccggacggacggcaagaaatggcggtgct
cgagggatgcggtcgccgaccagaagtactgtgagcgacacatgaaccggggacgccacc
gttcaagaaagcatgtggaaggccagcctggccatgccgcgaaagcgatgcccgcggcgg
tggcagcagccgctgcCTCTGCTACCCAGCCTAGTGCTCCGGCCGCCCACAGTGGCGGAG
CTGTTGCTGGCCTCGCTATCAACCATCAGCACCAGCAAATGAAGAACTACGCTGCCAACA
CTGCCAATCCTTGCTCTCTGCAATATAGCAGGGATCTGGCAAACAAGCATAATGAGAGTG
AACAAGTGCAAGACTCAGACAGTCTCTCGATGCTGACTTCCATTAGCACGAGAAATACGG
GCAGCCTGTTTCCGTTCTCAAAACAACATAATCCTTTTGAAGTGTCCAACTCAAGGCCAG
ATTTTGGCCTAGTATCACCTGATTCACTGATGAGTTCTCCTCATAGCTCCTTGGAGAACG
TCAATTTGCTCACTTCGCAGAGTCTGAATGAACAACAGAGTTCAGTTTCCCTTCAACACT
TTGTGGACTGGCCAAGGACACCTGCACAAGGAGCTCTCGCATGGCCTGATGCTGAAGACA
TGCAAGCTCAGAGAAGCCAGCTCTCAATATCTGCTCCAATGGCGTCTTCTGACCTGTCAT
CAGCCTCAACATCTCCCATCCATGAGAAGCTGATGTTGTCACCACTTAAACTGAGCCGTG
AATATAGTCCTATTGGTCTCGGTTTTGCAGCAAATAGAGATGAGGTTAACCAGGGAGAAG
CAAACTGGATGCCTATGTTCCGTGATTCTTTGATGGGCGGACCATTGGGAGAGGTTTTAA
CCAAGAATAACAACATGGAAGCAAGGAATTGCCTATCGGAGTCTCTGAATCTTTTAAATG
ATGGCTGGGATTCAAGCTCAGGGTTTGATTCATCCCCAGTTGGTGTTCTGCAGAAGACCA
CCTTTGGATCAGTATCCAGTAGCACCGGAAGCAGTCCTAGACTGGAGAATCATAGTGTTT
ATGATGGCAACAGTAACCTGCGGGATGATCTCGGTTCAGTTGTTGTAAATCATCCGAGCA
TCCGCCTGGTGTGAGCTTCTTGATCAACAAAAAATGCAACAAGATGACAGGCATGAGGAA
ACGATTCAATCAGTCTTCACCTTGTTACATATCGTTATGACGTCTTCAAGTGTGAGCATT
TACCTCGGTGCTTTGTCATTCAGACTAATCTTGTGTTTTTGGTATTTCTGCTCTGTTATT
TTTCCTTTGCTTTGTAACCTTCACCTTGGATCTTGACGTGATATGACGTGTGGTATGGAT
GGATTTGGTACTCCATTGTGGCATATCATCTTAAAATATCCCATGCTGTGACGTCATAAT
CGCGGATGAATGTAATCCGATCCTTGTCTTGCTTTCTGGTAGTATTCAATGGATTGTTTG
TGAGCTGAT

CDS

1371 bp

>Os03t0729500-01 Transcription factor, Floral organ development
atgcagggtgcaatggccagggtgaggggtcccttcacgccgtctcagtggatcgagctg
gagcaccaggcgctgatatacaagtacttggctgcgaatagccctgtaccacacagcctc
ctcatccccatcaggaggagcctcacatcgccctactcacctgccTACTTTGGCTCAAGC
ACATTGGGATGGGGATCTTTCCAGCtgggctactccggcagcgcggatccggagcccggc
cggtgccgccggacggacggcaagaaatggcggtgctcgagggatgcggtcgccgaccag
aagtactgtgagcgacacatgaaccggggacgccaccgttcaagaaagcatgtggaaggc
cagcctggccatgccgcgaaagcgatgcccgcggcggtggcagcagccgctgcCTCTGCT
ACCCAGCCTAGTGCTCCGGCCGCCCACAGTGGCGGAGCTGTTGCTGGCCTCGCTATCAAC
CATCAGCACCAGCAAATGAAGAACTACGCTGCCAACACTGCCAATCCTTGCTCTCTGCAA
TATAGCAGGGATCTGGCAAACAAGCATAATGAGAGTGAACAAGTGCAAGACTCAGACAGT
CTCTCGATGCTGACTTCCATTAGCACGAGAAATACGGGCAGCCTGTTTCCGTTCTCAAAA
CAACATAATCCTTTTGAAGTGTCCAACTCAAGGCCAGATTTTGGCCTAGTATCACCTGAT
TCACTGATGAGTTCTCCTCATAGCTCCTTGGAGAACGTCAATTTGCTCACTTCGCAGAGT
CTGAATGAACAACAGAGTTCAGTTTCCCTTCAACACTTTGTGGACTGGCCAAGGACACCT
GCACAAGGAGCTCTCGCATGGCCTGATGCTGAAGACATGCAAGCTCAGAGAAGCCAGCTC
TCAATATCTGCTCCAATGGCGTCTTCTGACCTGTCATCAGCCTCAACATCTCCCATCCAT
GAGAAGCTGATGTTGTCACCACTTAAACTGAGCCGTGAATATAGTCCTATTGGTCTCGGT
TTTGCAGCAAATAGAGATGAGGTTAACCAGGGAGAAGCAAACTGGATGCCTATGTTCCGT
GATTCTTTGATGGGCGGACCATTGGGAGAGGTTTTAACCAAGAATAACAACATGGAAGCA
AGGAATTGCCTATCGGAGTCTCTGAATCTTTTAAATGATGGCTGGGATTCAAGCTCAGGG
TTTGATTCATCCCCAGTTGGTGTTCTGCAGAAGACCACCTTTGGATCAGTATCCAGTAGC
ACCGGAAGCAGTCCTAGACTGGAGAATCATAGTGTTTATGATGGCAACAGTAACCTGCGG
GATGATCTCGGTTCAGTTGTTGTAAATCATCCGAGCATCCGCCTGGTGTGA

Protein

457 aa

>Os03t0729500-01 Transcription factor, Floral organ development
MQGAMARVRGPFTPSQWIELEHQALIYKYLAANSPVPHSLLIPIRRSLTSPYSPAYFGSS
TLGWGSFQLGYSGSADPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG
QPGHAAKAMPAAVAAAAASATQPSAPAAHSGGAVAGLAINHQHQQMKNYAANTANPCSLQ
YSRDLANKHNESEQVQDSDSLSMLTSISTRNTGSLFPFSKQHNPFEVSNSRPDFGLVSPD
SLMSSPHSSLENVNLLTSQSLNEQQSSVSLQHFVDWPRTPAQGALAWPDAEDMQAQRSQL
SISAPMASSDLSSASTSPIHEKLMLSPLKLSREYSPIGLGFAANRDEVNQGEANWMPMFR
DSLMGGPLGEVLTKNNNMEARNCLSESLNLLNDGWDSSSGFDSSPVGVLQKTTFGSVSSS
TGSSPRLENHSVYDGNSNLRDDLGSVVVNHPSIRLV*

5'UTR

chr03:29823449..29823531 (+ strand) : 83 bp

CDS

chr03:29823532..29823715 (+ strand) : 184 bp

chr03:29823862..29824225 (+ strand) : 364 bp

chr03:29824639..29825461 (+ strand) : 823 bp

3'UTR

chr03:29825462..29825816 (+ strand) : 355 bp

FASTA

>Os03t0729500-01 class=Sequence position=chr03:29823449..29825816 (+ strand)
GTTGGCTTGC ACTGCCTAGC TTGTTGCTCA TCTCCTTGGT GTATCTGGCT GCAGGATTGA GCTCAGTGAG CTTGagcagc
agcatgcagg gtgcaatggc cagggtgagg ggtcccttca cgccgtctca gtggatcgag ctggagcacc aggcgctgat
atacaagtac ttggctgcga atagccctgt accacacagc ctcctcatcc ccatcaggag gagcctcaca tcgccctact
cacctgccTA CTTTGGCTCA AGCACATGTA AGCCAAGAAA TGGGAAAGGA AGCAGATCAA CCGAATGCTT TCTTGGCTTT
AGTTCCTTTC ATCATGGACT GATATTTATG ATAAAAGCTG TTCCATTCCC TGATCTTGGT TGCATTGCCC TTGGTTGGGT
TTTTGCTTTG CAGTGGGATG GGGATCTTTC CAGCtgggct actccggcag cgcggatccg gagcccggcc ggtgccgccg
gacggacggc aagaaatggc ggtgctcgag ggatgcggtc gccgaccaga agtactgtga gcgacacatg aaccggggac
gccaccgttc aagaaagcat gtggaaggcc agcctggcca tgccgcgaaa gcgatgcccg cggcggtggc agcagccgct
gcCTCTGCTA CCCAGCCTAG TGCTCCGGCC GCCCACAGTG GCGGAGCTGT TGCTGGCCTC GCTATCAACC ATCAGCACCA
GCAAATGAAG AACTACGCTG CCAACACTGC CAATCCTTGC TCTCTGCAAT ATAGCAGGTA GAATGTTGGC AGCACTTTCA
AGCTCCAAAT ATTGCTTTTA GTCAATCATG TAGCCAATGC TTAAGCTCAA GACGTCAAGT TTCGCTTTTG CCATTTTGCA
TGGATATTCC ATTTCCGTAC ATATTTGCCT GCCGGCATCC ACCAAATAAT AAAGATAGAA GGTAATTTAG TTACCTAGTT
TATTTAGCTA CCATGATTGG AGATGAGCCC CAAAGATAAG CTATTAATCA TTTACCAGCA ATTAAACAAG TCCATTATTT
ACATTGCTCA TCTATGTACT CTGGTAGCCC TAAAGGTACT TGTTTTGTGA GTAGAGTGGC CGTTGAAGAA CTGCCATACT
AAAGGAACAA CTGCTATATG CTGTATTAAC TACTTCACTA ATGAATCACT TGTTGATCAA ACTTCTACAG GGATCTGGCA
AACAAGCATA ATGAGAGTGA ACAAGTGCAA GACTCAGACA GTCTCTCGAT GCTGACTTCC ATTAGCACGA GAAATACGGG
CAGCCTGTTT CCGTTCTCAA AACAACATAA TCCTTTTGAA GTGTCCAACT CAAGGCCAGA TTTTGGCCTA GTATCACCTG
ATTCACTGAT GAGTTCTCCT CATAGCTCCT TGGAGAACGT CAATTTGCTC ACTTCGCAGA GTCTGAATGA ACAACAGAGT
TCAGTTTCCC TTCAACACTT TGTGGACTGG CCAAGGACAC CTGCACAAGG AGCTCTCGCA TGGCCTGATG CTGAAGACAT
GCAAGCTCAG AGAAGCCAGC TCTCAATATC TGCTCCAATG GCGTCTTCTG ACCTGTCATC AGCCTCAACA TCTCCCATCC
ATGAGAAGCT GATGTTGTCA CCACTTAAAC TGAGCCGTGA ATATAGTCCT ATTGGTCTCG GTTTTGCAGC AAATAGAGAT
GAGGTTAACC AGGGAGAAGC AAACTGGATG CCTATGTTCC GTGATTCTTT GATGGGCGGA CCATTGGGAG AGGTTTTAAC
CAAGAATAAC AACATGGAAG CAAGGAATTG CCTATCGGAG TCTCTGAATC TTTTAAATGA TGGCTGGGAT TCAAGCTCAG
GGTTTGATTC ATCCCCAGTT GGTGTTCTGC AGAAGACCAC CTTTGGATCA GTATCCAGTA GCACCGGAAG CAGTCCTAGA
CTGGAGAATC ATAGTGTTTA TGATGGCAAC AGTAACCTGC GGGATGATCT CGGTTCAGTT GTTGTAAATC ATCCGAGCAT
CCGCCTGGTG TGAGCTTCTT GATCAACAAA AAATGCAACA AGATGACAGG CATGAGGAAA CGATTCAATC AGTCTTCACC
TTGTTACATA TCGTTATGAC GTCTTCAAGT GTGAGCATTT ACCTCGGTGC TTTGTCATTC AGACTAATCT TGTGTTTTTG
GTATTTCTGC TCTGTTATTT TTCCTTTGCT TTGTAACCTT CACCTTGGAT CTTGACGTGA TATGACGTGT GGTATGGATG
GATTTGGTAC TCCATTGTGG CATATCATCT TAAAATATCC CATGCTGTGA CGTCATAATC GCGGATGAAT GTAATCCGAT
CCTTGTCTTG CTTTCTGGTA GTATTCAATG GATTGTTTGT GAGCTGAT

Locus: Os03g0729500

Loading...

Locus: Os03g0729500

Loading...