Os03t0733600-01

Locus

Os03g0733600

Description

Transcriptional cofactor, Ortholog of Arabidopsis ANGUSTIFOLIA3(AN3), Regulation of stem, leaf and grain size, Positive regulation of cell proliferation

RAP-DB Gene Symbol Synonym(s)

OsGIF1, MKB3

RAP-DB Gene Name Synonym(s)

Growth-regulating factor interacting factor 1, GRF interacting factor 1, MAKIBA3

CGSNL Gene Symbol

GIF3

CGSNL Gene Name

GRF-INTERACTING FACTOR 3

Oryzabase Gene Symbol Synonym(s)

OsGIF3, OsGIF1, GIF1, MKB3

Oryzabase Gene Name Synonym(s)

GRF1-interacting factor 3, GRF-interacting factor 3, Growth-regulating factor interacting factor 1, GRF interacting factor 1, MAKIBA3, MAKIBA 3

Transcript Evidence

AK058575

Protein Evidence

Q6AVI1

Literature

PMID: 29567670

PMID: 29051769

Note

Manual Curation

January 15, 2019

Gene Ontology (GO)

Molecular Function: transcription coactivator activity (GO:0003713)

Functional domain (InterPro)

SS18 family (IPR007726)

Experimentally confirmed subcellular location

nucleus (GO:0005634) [mainly]

cytoplasm (GO:0005737)

Full-length cDNA

001-017-F01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0733600-01)

RiceXPro (AK058575)

Others

Oryzabase (9796)

KEGG (Os03t0733600-01)

Transcript

1254 bp

>Os03t0733600-01 Transcriptional cofactor, Ortholog of Arabidopsis ANGUSTIFOLIA3(AN3), Regulation of stem, leaf and grain size, Positive regulation of cell proliferation
AAAGCGAAAGGAGGAGACGGCCAACCAAAACCCTCCTCCTCTCATCATCGCCCAAAACCC
CCCAAGAAACCAGAAAGAAACCTCTCCTGCTCCTCTCTCTCTCTTTTCACCGGCAGAGGG
AGAGGAAGTGGAGAGACAGAGAGGAAGAAGCAGAGGGAAGAAAAGAAAAGGAAGGAGTTT
GCTGCAGCTGTGAGGAGTAGAGGAGGGGGGAAGGGTATAAAGGTTTTTGATTGGAATGCA
GCAGCAACACCTGATGCAGATGAACCAGGGCATGATGGGGGGATATGCTTCCCCTACCAC
CGTCACCACTGATCTCATTCAGCAGTATCTGGATGAGAACAAGCAGCTGATCCTGGCCAT
CCTTGACAACCAGAACAATGGGAAGGTGGAAGAGTGCGCTCGGAACCAAGCTAAGCTCCA
GCACAATCTCATGTACCTCGCCGCCATCGCCGACAGCCAGCCGCCGCAGACGGCCGCCAT
GTCCCAGTATCCGTCGAACCTGATGATGCAGTCCGGGGCGAGGTACATGCCGCAGCAGTC
GGCGCAGATGATGGCGCCGCAGTCGCTGATGGCGGCGAGGTCTTCGATGATGTACGCGCA
GCCGGCGCTGTCGCCGCTCCAGCAGCAGCAGCAGCAGCAGGCGGCGGCGGCGCACGGGCA
GCTGGGCATGGGCTCGGGGGGCACCACCAGCGGGTTCAGCATCCTCCACGGcgaggccag
catgggcggcggcggcggcggcggtggcgccggtaacagcatgatgaacgccggcgtgtt
ctccgacttcggacgcggcggcggcggcggcggcaaggaggggtccacctcgctgtccgt
cgacgtccggggcgccaactccggcgcccagagcggcgacggggagtacctcaagggcac
cgaggaggaaggcagctaggtggTTTAACTTAGCTATAGCTAAGCTAGGCAGCTAGGTAG
CCCATGAGGAGGGTAGCACCGTGGTAGTAGCAGTAGTAGCTAGGAGACGGCGGCAATGGC
GGTGACGGTGACGGCGATGTCGGTGGCGGTGGTGGCTAAGGTTTAGGTTTGGTAGGTCGA
TCCATGGAACCTGTGTGGTGGTGGTGGCCTGATGCATGTTGCATTTGGTATCATGCAGAA
GTCTCACTTGTTTTGGAAAACGGATTGGCAGGTTCGTCTAATTAAGATGTGTTATTAGTA
AGGGAATATATGTGTGTGTTGCTGCACTGCAATGGATGGGTTGGTTGGTTTGCG

CDS

684 bp

>Os03t0733600-01 Transcriptional cofactor, Ortholog of Arabidopsis ANGUSTIFOLIA3(AN3), Regulation of stem, leaf and grain size, Positive regulation of cell proliferation
ATGCAGCAGCAACACCTGATGCAGATGAACCAGGGCATGATGGGGGGATATGCTTCCCCT
ACCACCGTCACCACTGATCTCATTCAGCAGTATCTGGATGAGAACAAGCAGCTGATCCTG
GCCATCCTTGACAACCAGAACAATGGGAAGGTGGAAGAGTGCGCTCGGAACCAAGCTAAG
CTCCAGCACAATCTCATGTACCTCGCCGCCATCGCCGACAGCCAGCCGCCGCAGACGGCC
GCCATGTCCCAGTATCCGTCGAACCTGATGATGCAGTCCGGGGCGAGGTACATGCCGCAG
CAGTCGGCGCAGATGATGGCGCCGCAGTCGCTGATGGCGGCGAGGTCTTCGATGATGTAC
GCGCAGCCGGCGCTGTCGCCGCTCCAGCAGCAGCAGCAGCAGCAGGCGGCGGCGGCGCAC
GGGCAGCTGGGCATGGGCTCGGGGGGCACCACCAGCGGGTTCAGCATCCTCCACGGcgag
gccagcatgggcggcggcggcggcggcggtggcgccggtaacagcatgatgaacgccggc
gtgttctccgacttcggacgcggcggcggcggcggcggcaaggaggggtccacctcgctg
tccgtcgacgtccggggcgccaactccggcgcccagagcggcgacggggagtacctcaag
ggcaccgaggaggaaggcagctag

Protein

228 aa

>Os03t0733600-01 Transcriptional cofactor, Ortholog of Arabidopsis ANGUSTIFOLIA3(AN3), Regulation of stem, leaf and grain size, Positive regulation of cell proliferation
MQQQHLMQMNQGMMGGYASPTTVTTDLIQQYLDENKQLILAILDNQNNGKVEECARNQAK
LQHNLMYLAAIADSQPPQTAAMSQYPSNLMMQSGARYMPQQSAQMMAPQSLMAARSSMMY
AQPALSPLQQQQQQQAAAAHGQLGMGSGGTTSGFSILHGEASMGGGGGGGGAGNSMMNAG
VFSDFGRGGGGGGKEGSTSLSVDVRGANSGAQSGDGEYLKGTEEEGS*

5'UTR

chr03:30048561..30048795 (- strand) : 235 bp

CDS

chr03:30048471..30048560 (- strand) : 90 bp

chr03:30046877..30046953 (- strand) : 77 bp

chr03:30046049..30046133 (- strand) : 85 bp

chr03:30045516..30045947 (- strand) : 432 bp

3'UTR

chr03:30045181..30045515 (- strand) : 335 bp

FASTA

>Os03t0733600-01 class=Sequence position=chr03:30045181..30048795 (- strand)
AAAGCGAAAG GAGGAGACGG CCAACCAAAA CCCTCCTCCT CTCATCATCG CCCAAAACCC CCCAAGAAAC CAGAAAGAAA
CCTCTCCTGC TCCTCTCTCT CTCTTTTCAC CGGCAGAGGG AGAGGAAGTG GAGAGACAGA GAGGAAGAAG CAGAGGGAAG
AAAAGAAAAG GAAGGAGTTT GCTGCAGCTG TGAGGAGTAG AGGAGGGGGG AAGGGTATAA AGGTTTTTGA TTGGAATGCA
GCAGCAACAC CTGATGCAGA TGAACCAGGG CATGATGGGG GGATATGCTT CCCCTACCAC CGTCACCACT GATCTCATTC
AGCAGGTCAT GATCCCCTCT CCCCAAAATC TCTCCCATTT TATCGTCTGT TTGTCTCTCT CTTGTTTTTC ATTTCTTGCT
TTTTGTTTTT GGTTCCGTGA TCTCTCTTCT TTCCTTTCTT TTTTTTTCTC TTGAATCATT TGTATCAAAC TCTTTTTTTC
TTCGTTCTTG ATTCGTTGGT TGGTCTGTGA GTATCTGAAA AAGAAGTTTT ATCTTTTCTT GTGTTCCCCT TTTCTATTTC
ATTATGCGTT TATGCTCATG CTATCTTTCT TGTTTGCTCG TGGTTGTTGA TCCTCTTTTG TATCCATTGA AACATCTGGC
AAAAAAAAAT CTGAAATGAA CTAAAGTTTC CCTTCTTTTT TTTTTCTCTG TTCTTACATC TTGTTCATCT GATCTATTTC
GCTTTCTCCG TTAATTCCCA ACATGATTTG TCGAACAACA CGTTTTTTCC ATCATATTTA AAAAATAGTT CTAGGGCAGC
CTTTTTTTTC TTTATTTTGT TTGGTCAAAT AGAAAGGGCA TGATCCTCTT ATATTCATGA TGTTGATTTA TCTTCTCGTC
CTCTAGTCTT CTCCCTGTAT TCTCATGTCT TCAAACATGG TCCCTCACAT CTGATTTCCT CTGCAGTTCA AACTGTTGCT
GTCCATTTGG TCCTTTTTTT TTCTTTTCTT TTGCTCTTGC TGCTCACATA GTCACATGAT GCGGTGATTT TTTACATATC
CTTTATCCCC CTCTCCATCT AAATCCTATT TTTAGCTTGT TTTGGTTGGT GACTTGTGCC AATGGTCGTG TCTCCCCCAC
CACTCGTATT TGGCAACTAG TAAACATGCC AGACCTGTTC CCTGCATCTG CCATTGCAGA CCACCAATAA ATCTTGGCCC
CCTTTCCATG TAAATGTATC ATGTGCAATC GTCCAACAAA AGGGAGCAAG AAATGCTGTG AGATTTACAT AAATATCTCC
TTTCCATATC CGAAATCCAA TTTGCAATCT TTGATTTAAA AAATATTTCT TTTTTCTTCA GAAGGACATA CCATACAAGA
TCTGGTCCTT GTTCATGTTG GTGAGAAACT GGGAATGTAG GTTGGCTTGT GCTGTACTAG AATGCCACAG GTTGCAGTTT
TGACTGTTAG ACCCCTAAAA GATGTGAGCT TTATGGCTAA AGGCCGATAT AACAACCAGG GGCCCGGTCT GCTTGGCCTA
TTCTTTGATA ACCTGCTTGC ATGCTATCGT GCCAGTTCAT GATTGGTCCT CAGTTTGAGA TGATAGGCTG GCAATCAGAT
CTTGTGTGGT TCTGCTCTAG AATCAGGACG CCAATCTCCA GTCTAGTACT TCATTGGTGC TAGGAGTATA TTCATGCATA
TGTCATTGGT GATAAACTGA TAGTACCAAC CAAATCTTGT GCAATGAACT GCAATATATT CAAGGCATGC ATGCAGTACT
ATCTTTTGTT AGTATTGATG ATAAAGACTT TGAAATGTAA TGACGTATTA ACATGCAAAG ATTCAACCTT GAAACTGTGC
AGTATCTGGA TGAGAACAAG CAGCTGATCC TGGCCATCCT TGACAACCAG AACAATGGGA AGGTGGAAGA GTGCGCTCGG
TGAGTTTGAT CTTGATCTCC CTGTTATCAT GGAGTGCTGT GAAAACTCTG AAGTTGCTGT TCTTTCTGTA GCTTTTGCTC
TATCAGAGAT GTCTTGTTTG GTAATATAGT CTTTAGGCTT TGTTAACTGC AAAAGGAATG TCTAGCTTTT GTTCAGTCAG
GGTTCAAGAA ACTAGAATCT ACTAGGAGTA TTCTGGATAA ATCAACTAAT CAAGTAGTAC AATGTTCTTT GGTGAAATAT
TCCATTAGGT GTTACAGGTG ATTCCACAAT GATGGTTGAA TTAGTGTTAA CTCATGGGCA GGTTAATACT ATACCTAGCA
CCCTCCTGTT AAATAAATTA TTAGTGAGTG GCTTGTACTA GAAAAGTACT GTTCCTTGTT CAGTGCACTA TTTCTGTTGT
GTGTATTGTC AATGTCACAG AACAGTTTGC TGCCATCCTC CACAGTATCT TTTCCAGCCA CCGCACAGAA GCAAACTCGA
TCCAAAGCCT CCTCATTTTT CAATCATCAT CATGTCACGT AGTAGTAGTA ATACGAGTTG CATGCATGTT CATGTGCATA
CGCTCTCCTG TTGTTCACTG CTGCTGCTAT CTTTCTTGGA TTGTACCGGG AAGGGAACAC ATCAGTTTGG AGCTTTGCAT
CGACTGAGCA ATCCACCCAC GTTTTCGCTT GCGGCGCGGC GTTTTGCATT TGCCCTACAG GCAGCTCACA AGCTGACCAT
CCTCGCGTGT CTGTCGCTGC AGGAACCAAG CTAAGCTCCA GCACAATCTC ATGTACCTCG CCGCCATCGC CGACAGCCAG
CCGCCGCAGA CGGCCGCCAT GTCCCAGGTA ATTGTGCTGC TGGCGATGAT CAGTGAGTCG TGTTTGTTGG TGTTTGATTT
GAGGATGAGT GAAGTCATCA ATGGCGGCTG CATTGTGCAT GGATGCAGTA TCCGTCGAAC CTGATGATGC AGTCCGGGGC
GAGGTACATG CCGCAGCAGT CGGCGCAGAT GATGGCGCCG CAGTCGCTGA TGGCGGCGAG GTCTTCGATG ATGTACGCGC
AGCCGGCGCT GTCGCCGCTC CAGCAGCAGC AGCAGCAGCA GGCGGCGGCG GCGCACGGGC AGCTGGGCAT GGGCTCGGGG
GGCACCACCA GCGGGTTCAG CATCCTCCAC GGcgaggcca gcatgggcgg cggcggcggc ggcggtggcg ccggtaacag
catgatgaac gccggcgtgt tctccgactt cggacgcggc ggcggcggcg gcggcaagga ggggtccacc tcgctgtccg
tcgacgtccg gggcgccaac tccggcgccc agagcggcga cggggagtac ctcaagggca ccgaggagga aggcagctag
gtggTTTAAC TTAGCTATAG CTAAGCTAGG CAGCTAGGTA GCCCATGAGG AGGGTAGCAC CGTGGTAGTA GCAGTAGTAG
CTAGGAGACG GCGGCAATGG CGGTGACGGT GACGGCGATG TCGGTGGCGG TGGTGGCTAA GGTTTAGGTT TGGTAGGTCG
ATCCATGGAA CCTGTGTGGT GGTGGTGGCC TGATGCATGT TGCATTTGGT ATCATGCAGA AGTCTCACTT GTTTTGGAAA
ACGGATTGGC AGGTTCGTCT AATTAAGATG TGTTATTAGT AAGGGAATAT ATGTGTGTGT TGCTGCACTG CAATGGATGG
GTTGGTTGGT TTGCG

Locus: Os03g0733600

Loading...

Locus: Os03g0733600

Loading...