Os03t0734900-00

Locus

Os03g0734900

Description

Similar to CCT motif family protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GATA19

CGSNL Gene Name

GATA TRANSCRIPTION FACTOR 19

Oryzabase Gene Symbol Synonym(s)

OsTIFY1b, TIFY1B, OsCCT15, OsGATA19, OsGATA19a, OsGATA19b

Oryzabase Gene Name Synonym(s)

TIFY GENE 1B, TIFY-DOMAIN PROTEIN 1B, CCT domain-containing gene 15, CCT (CO, CO-LIKE and TOC1) domain protein 15, CCT domain protein 15, GATA transcription factor 19, GATA factor 19

Transcript Evidence

EU958286 (DDBJ)

Protein Evidence

Q10DB3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Zinc finger, GATA-type (IPR000679)

Tify (IPR010399)

CCT domain (IPR010402)

Zinc finger, NHR/GATA-type (IPR013088)

Expression Databases

TENOR (Os03t0734900-00)

Others

Oryzabase (15740)

KEGG (Os03t0734900-00)

Transcript

954 bp

>Os03t0734900-00 Similar to CCT motif family protein, expressed.
GTCCGCGGCCCATCTCCACCGTCCGATCCCGAGCCGATGGCGGCGGAGCCCCCGGCGGAC
GGCCGCGATCCCCCGGCGGACGATGGCGCCGCCGGCGACGGCGCGGTGGAGTCCGCGGCG
GCGGAGGCGCTCCTGAGCGCGGCGTCGGAGCAGCTGACGCTCGTGTACCAGGGGGAGGTC
TACGTCTTCGACCCCGTCCCGCCCCAAAAGGTTCAGGCTGTTCTATTGGTACTTGGAGGG
TCTGACATGCCTCCTGGTTTAGTAAGCATGGCTGTACCTACCACATTCGATGAAAAGAGT
ACAACTGTGGCTGCCAGAAGAGTTGCTTCCTTAATGAGGTTTCGTGAGAAGAGGAAGGAA
AGATGTTTTGATAAGAAAATAAGATACAGTGTTCGTAAGGAGGTTGCTCAAAAGATGAAA
CGACGTAAAGGCCAGTTTGCTGGAAGGGCAGACTTTGGTGATGGTTCATGTTCTTCTGCA
CCATGCGGCTCCACAGCCAATGGCGAGGATGATCATATCCGAGAAACGCATTGCCAAAAT
TGTGGCATCAGCTCAAGGCTTACTCCAGCAATGCGTCGTGGGCCAGCTGGTCCAAGGTCC
CTCTGTAATGCCTGTGGCCTAATGTGGGCAAACAAGGGCACCCTAAGAAGTCCTTTGAAT
GCCCCCAAAATGACTGTGCAGCATCCTGCTGATCTGAGTAAAACGGGTGATACAGATGAC
AGCAAAGCAAATCTGTGTGCTGAGCATAATCAAACCACTATGAAAACTGACACTGAGATG
GTGCCAGAGCAGGAGCAGAAGGCAGACGTGTTGCCACCAACCAAAGAAGAAGATAGCATG
GCTACCTCGTGACAAAATGTTCAGACGCTTGTGTATAATTGATACGTAGGTTATTTTTCA
GGAACTCCTGACTTTAGGATGGTACATAAGGCAACAGAACTAACAAAGATCAGC

CDS

816 bp

>Os03t0734900-00 Similar to CCT motif family protein, expressed.
ATGGCGGCGGAGCCCCCGGCGGACGGCCGCGATCCCCCGGCGGACGATGGCGCCGCCGGC
GACGGCGCGGTGGAGTCCGCGGCGGCGGAGGCGCTCCTGAGCGCGGCGTCGGAGCAGCTG
ACGCTCGTGTACCAGGGGGAGGTCTACGTCTTCGACCCCGTCCCGCCCCAAAAGGTTCAG
GCTGTTCTATTGGTACTTGGAGGGTCTGACATGCCTCCTGGTTTAGTAAGCATGGCTGTA
CCTACCACATTCGATGAAAAGAGTACAACTGTGGCTGCCAGAAGAGTTGCTTCCTTAATG
AGGTTTCGTGAGAAGAGGAAGGAAAGATGTTTTGATAAGAAAATAAGATACAGTGTTCGT
AAGGAGGTTGCTCAAAAGATGAAACGACGTAAAGGCCAGTTTGCTGGAAGGGCAGACTTT
GGTGATGGTTCATGTTCTTCTGCACCATGCGGCTCCACAGCCAATGGCGAGGATGATCAT
ATCCGAGAAACGCATTGCCAAAATTGTGGCATCAGCTCAAGGCTTACTCCAGCAATGCGT
CGTGGGCCAGCTGGTCCAAGGTCCCTCTGTAATGCCTGTGGCCTAATGTGGGCAAACAAG
GGCACCCTAAGAAGTCCTTTGAATGCCCCCAAAATGACTGTGCAGCATCCTGCTGATCTG
AGTAAAACGGGTGATACAGATGACAGCAAAGCAAATCTGTGTGCTGAGCATAATCAAACC
ACTATGAAAACTGACACTGAGATGGTGCCAGAGCAGGAGCAGAAGGCAGACGTGTTGCCA
CCAACCAAAGAAGAAGATAGCATGGCTACCTCGTGA

Protein

272 aa

>Os03t0734900-00 Similar to CCT motif family protein, expressed.
MAAEPPADGRDPPADDGAAGDGAVESAAAEALLSAASEQLTLVYQGEVYVFDPVPPQKVQ
AVLLVLGGSDMPPGLVSMAVPTTFDEKSTTVAARRVASLMRFREKRKERCFDKKIRYSVR
KEVAQKMKRRKGQFAGRADFGDGSCSSAPCGSTANGEDDHIRETHCQNCGISSRLTPAMR
RGPAGPRSLCNACGLMWANKGTLRSPLNAPKMTVQHPADLSKTGDTDDSKANLCAEHNQT
TMKTDTEMVPEQEQKADVLPPTKEEDSMATS*

5'UTR

chr03:30099058..30099093 (- strand) : 36 bp

CDS

chr03:30098884..30099057 (- strand) : 174 bp

chr03:30096500..30096586 (- strand) : 87 bp

chr03:30096300..30096415 (- strand) : 116 bp

chr03:30095436..30095552 (- strand) : 117 bp

chr03:30095221..30095326 (- strand) : 106 bp

chr03:30094999..30095067 (- strand) : 69 bp

chr03:30094848..30094921 (- strand) : 74 bp

chr03:30094537..30094609 (- strand) : 73 bp

3'UTR

chr03:30094435..30094536 (- strand) : 102 bp

FASTA

>Os03t0734900-00 class=Sequence position=chr03:30094435..30099093 (- strand)
GTCCGCGGCC CATCTCCACC GTCCGATCCC GAGCCGATGG CGGCGGAGCC CCCGGCGGAC GGCCGCGATC CCCCGGCGGA
CGATGGCGCC GCCGGCGACG GCGCGGTGGA GTCCGCGGCG GCGGAGGCGC TCCTGAGCGC GGCGTCGGAG CAGCTGACGC
TCGTGTACCA GGGGGAGGTC TACGTCTTCG ACCCCGTCCC GCCCCAAAAG GTCGCGCCCT TTTTCACCCC TTCCAAAATT
TTTTTCCATC GCGTCCGTTT GGTTCTTCCC TTTCGCCCTT TCGGTAGCTC CGGTGAGTGG GGTTGACTTT GCGCGCGGTG
GCGCGGGAGA TTGGCGAGGG TGGGCTGCGG GGGCCGAATT GGACTAGGGG ATTCGCGTTT CGTTGGCGAT GCTGCTTGGT
TTTCGGAGAA GGCGGCGTCC TCGTGATGAA TTTGGTGTGC CTTTTCTTCG ATTTTGAATG TGTTGTTGCG GTAGAATGGA
GCGATGGAAA TTAGCATGCA TGTTTCCTCC GATTGCACCA AGCGAGCAAT CTTTTTGGGT GTAATTGGTT GGTTTGATGA
ATAGATTGGC CATTTTTGTT TGCTCTAGGT TGAGCAGAGG TCTGTTTGCG TCCTCGTTGA ATTTCGCCAG AGAATGCGTA
CTCTGTGACT TTGTGCTACT GTGTTAACAG TAATTTGTCG ATTGATCGTC TAGGAAATTG GGTATTGTTC TAATTAGGAT
TGACTTTTTT TAAATGTATA CCAGTTGATT ATATGCTGTT TCTTGCGGAA TTTAGTTTCG TGTGCTTGTC TGCTTGATTT
GCTATATCTC ATCGATTTCT ATTTGACTTT CTACAGAAAA TGGAGGCTTT CTTAGATAGA TTTGACCTTT TGCTGCCTTC
TTTCATGTCT TTTTAGTGCC TATCTTTGGT GAATTTGAGA ATAGGGTGCA AGTTTAAATG CTGCAACATC TGTTTTATTT
AGTTGAATGC ATTCCCAGCA TGTTGAATGG AGATAAGAAT TTGACTGTCT AATGAAACAA ATAGTACCAT CACTAATCAC
TTGTTTTGTT TGTGTTTGTA CCTTTTCCTT CTTATGCTAA ATTGCTAAGG CATTGATTTA TTTGCAAATG TGTAGTGCCA
CAGCCCACAC CTAAGTAGTC AACATATTTT CTCAGCTTTG ATAGGGGAAA AAGTGTACTT TAGGGCATGT TTTGGGATAT
AATTGTTACT ATTTTGTTAA GAAAAAGTAG CCCCATTGGC ATTGCTAGCA GTAGCAGGCA TCTGTCTCAA CACTAATGCT
CGTACTCATA TGTTGGTTTC ATCCAGTTGT TCAAAGAAGG GGGTCCATCT TCTCTGTTTA ACTTTATCTG CACTCATGTG
TTTTCTATTT CTTCTATCAC AAGTTTAGAG AAATGTACCT TTGATGAATC AAATGGCACT GGAAGAATAT ATTCTGTGCA
CATTGAAAAT GTTTTTTTTC CCTTTAGTTA ACAGTGTTTG GAACCAACGT AATGAATGCA TATTCAACAG GCAACTGAAA
TAAATTGACA CTAAAAGAGC TGAATAGTGT GCAAAGCATG TTAATTGTGG CCCTGGGTTA AGGTGGATTA TCTTGTACAG
TATATACTTC TTGTGATTAA TTCAGGTGGT TCTGGAGATT TGAGGGAGAA TGCTTGAGCT CTGACTTTTC TTCATTGGAA
AGTTGGAGCC ATCTAATTCT TAAGGAAATG CCATCTGGAG TAATCTGTGG TTCTGTCAAC CTCATAGTTG TTATGTATTT
TTTTTTTAGA AAAACATCTT TCATTTGATC CAATGCTTAC AAGGTGGTTT TGCATACCTT ATAATACAAA TGGCTTCAGG
AAAAGTGACA CACGCTAGCA TTTGCTTTGG TCTAGTTCAT TTTCTCAAAC ATAGTTTTCC CTTTTTTTAT TCAAGAGAGT
ATCTTTGACC TTGCAATCAT GAGAAGCCTT CTGGAGTCAT TTATAGTGAA AATCTTCATT AACAAAAAGG GAATATAACA
TATCTAGAAA CACATCCCTG TTGGTATGAA TTCCATCTAT TATACTGAGA TAATATACTG ACTATGTTGG ATGAAATATA
AGCTGGTAAA ATTGGCTTGA AAGAAACGTA AACCAAACGA CACACGCATA TAAATTGCTG GCTGATTCTG GTAAATGATT
ATGAGAATAA TGACATATTA TGCTGTGCAT ATAGTTAACC TGAGATGGAC ACATTCCCCT GATGGCAAAT AAGTGTGACT
CGGTTAAAAT GGAAATTTTT TCCAGCTGAT GTATTCACCA TGTGACCTTG GTCAAGGTGA CACACCTTTT CTAATCTGTA
TTCCTTCTCT TTTTTCAGCT TTTCCTGTCC CATGAATCAA TTGTGATGCA ACCATAGTAA AGTTTCAAGG GTGATCATGT
GCTTATGTTA CTAGTGATGA GCTGCTGTTT ATTGCTTTGG CTATTATATT GCTCATGGCC ATTTGTAGTT GATATACATG
ACTGACTGTT ATGTTAGTGT TATACAGGTT CAGGCTGTTC TATTGGTACT TGGAGGGTCT GACATGCCTC CTGGTTTAGT
AAGCATGGCT GTACCTACCA CATTCGATGA AAAGGTATCC ATGTTCTGTA GAATCTCTAC ACAAAGGTTG TTTGACTATT
TCTAGTTTCT CCTAAAGCTT TTACTGTGTC GTGTGTAGAG TACAACTGTG GCTGCCAGAA GAGTTGCTTC CTTAATGAGG
TTTCGTGAGA AGAGGAAGGA AAGATGTTTT GATAAGAAAA TAAGATACAG TGTTCGTAAG GAGGTTGCTC AAAAGTATGG
ACTTGACTCA TGCCCATTCC CTTCTGCACT GTCTAAAATA TACACGTTCT GAACATATTT CTACCATCAT AATTGCAGGG
TGAATGCATA TGCACTTTTA AATGGCATTC CTGACTTGCT AATTTAGTGT GAAAATGCTT GTTATATCAA ATTAACAATG
TTGTGATCTT TCATTATTAA TAAACCAGCA TTTTACCTGA TTCTTGTCAC ATCAACCTTT TCTTATAAGA CAATAAACTA
AGACAGATGG GGATATAGCT CTGTTGACTA GTATTTTTTT AAATTTTCCA TGTAGCTTAT CCGTTATGAC GTCACTTGTT
CTTGAATAGT TATAGAGGGA GTAATGATGG CTCAGAAATA TTTTCAGTAG CAATGAATAA CAGCATAAAA CTATGGGTCA
TGGAACAATC ATGTCTTACT GGTGCAATAA AAGTTTCTTA CATTGTAATT TGCCTTTGCA ATGTCACATT GCTAACTTTC
ATGGTTCTAA TATGCAAAAT GAATGTTTAC AGCACTTTAT TCCAATTGGT TATAAAAAAC CTGCTCTTGA TTTTTTGCCC
CATTTAGTAA GATTGGGCTG CTCTGAATAA ATAAATTGCT TTATCAGTAC CATGTCATTC AGTCATTCTC TGTTTACCAT
TCTTGGTACA GGCAGTCAAC ATAAGATTGC TGTTGAGCTA TTCTTCTGTA ACCATTTATT TTGTTTCAGA TGTTATAATA
TGCACGCATT ATAATTGTCA GGATGAAACG ACGTAAAGGC CAGTTTGCTG GAAGGGCAGA CTTTGGTGAT GGTTCATGTT
CTTCTGCACC ATGCGGCTCC ACAGCCAATG GCGAGGATGA TCATATCCGA GAAACGCAGT GAGTTAGTTG TCAACTGTGT
GTATGTGCAA GTCGTGTTAC ATCAATTCCA GATACTTGAA GCGGCTGCCT GTATATATTG TGCACTGATG TTGGTTTGCC
CTTCTAGTTG CCAAAATTGT GGCATCAGCT CAAGGCTTAC TCCAGCAATG CGTCGTGGGC CAGCTGGTCC AAGGTCCCTC
TGTAATGCCT GTGGCCTAAT GTGGGCAAAC AAGGTAATTT CCTCACTTTA TGAACACTGC TGCCTGTTTT GTTCACTCCT
TTTCTCTTGA ATATGTTTCT TTGTTTACGA GTAGGCTAAA TAACTATTGA TGTTATGGTC CATACTAACA CAATTGCTGT
AACTAAATCA CCCAAAAAAA ACTCAGGGCA CCCTAAGAAG TCCTTTGAAT GCCCCCAAAA TGACTGTGCA GCATCCTGCT
GATCTGAGTA AAACGGTGCG TTATGCCTGT AATATAAACT TGGTTTACCT GAACATTACA CTTTTGATTT ATTTGTGCTT
CTCATTGTAC AGGGTGATAC AGATGACAGC AAAGCAAATC TGTGTGCTGA GCATAATCAA ACCACTATGA AAACTGACAC
TGAGATGTAA GCAGTCCATG TTTACTGCAT CTTGATCAAA TGCAATCATG CAAACTAACA AGTGCACTCT AAACACAAGC
CTAAGCTTGG AACATACAGA ATACTCATGG TCAGGTTTTA AGTGAAAATT TTCGGCAGGC TTTACAGCTT TACTGCTGAA
AATGCTGCCT AAATAACTTC TTTGACTATA GATAAGTTTC TCAAAACACA ACTACTTGAC CATCTAATCT AGTTTCTTCG
TCAGGGTGCC AGAGCAGGAG CAGAAGGCAG ACGTGTTGCC ACCAACCAAA GAAGAAGATA GCATGGCTAC CTCGTGACAA
AATGTTCAGA CGCTTGTGTA TAATTGATAC GTAGGTTATT TTTCAGGAAC TCCTGACTTT AGGATGGTAC ATAAGGCAAC
AGAACTAACA AAGATCAGC

Locus: Os03g0734900

Loading...

Locus: Os03g0734900

Loading...