Os03t0736500-01

Locus

Os03g0736500

Description

Syntaxin-related protein KNOLLE (Syntaxin 111) (AtSYP111).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

KN, OsKN, OsSYP111, SYP111

Oryzabase Gene Name Synonym(s)

Syntaxin-related protein KNOLLE, OsKNOLLE, KNOLLE, Syntaxin of Plants 111

Transcript Evidence

AK287828 (DDBJ, Best hit)

Protein Evidence

NP_001149999.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: intracellular protein transport (GO:0006886)

Biological Process: vesicle-mediated transport (GO:0016192)

Cellular Component: membrane (GO:0016020)

Molecular Function: SNAP receptor activity (GO:0005484)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Target SNARE coiled-coil domain (IPR000727)

Syntaxin, N-terminal (IPR006011)

Syntaxin/epimorphin, conserved site (IPR006012)

t-SNARE (IPR010989)

Full-length cDNA

J065185H22 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0736500-01)

Others

Oryzabase (11823)

KEGG (Os03t0736500-01)

Transcript

1245 bp

>Os03t0736500-01 Syntaxin-related protein KNOLLE (Syntaxin 111) (AtSYP111).
CTCCTCACAGATCACCAGATCCCCTTCGCCTTCGCCTTCGCCTCACCACCAAACCCTAGA
GAAGCGAGAGAGAGGGAGAGATCTCCACGAGATTCGCCGCCATGAACGACCTCATGACCA
AGTCGTTCATGAGCTACGTCGACCTGAAGAAGGCGGCGATGAAGGACCTGGAGGCGGGCG
GGGATGgcgtggagctccccgaggtgggcgtcaccgacgagcgcctcaaggggttcttcc
aggagacggaggcggtggaggaggagatggccgccatccgcgacgcgctggCGAGGCTCA
ACGCCGCCAACGAGGAGGGCAAGTCGCTGCACCAGCCCGACGCCCTCCGCGCGCTCCGCG
GCCGCGTCAACGCCGACATCATCGCCGTGCTCCGCCGCGCGCGCGACATCCGCGCCAGGC
TCGAGGCCATGGACCGCGCCAACGCGGCGCAGCGCAGGCTCTCCGCGGGCTGCCGCGAGG
GCACCCCGCTCGACCGCACCCGCACCGCGCTCACCGCCGCGCTCCGGAAGAAGCTCAAGG
ACCTCATGCTCGACTTCCAGGCCCTGCGGCAGCGGATCATGTCCGAGTACAAGGACACCG
TCGAGCGCCGCTACTACACCCTCACCGGCGAGGTCCCCGAGGAGGAGGTGATCGAGCGCA
TCATCTCCGAGGGACGCAGCGAGGAGCTCCTGTGCGCCGCCGTGGCGGAGCACGGCAAGG
GCGCGGTGCTGGCCACGGTGCACGAGATCCAGGACCGCCACGACGCCGCCCGCGAGGTGG
AGCGCAGCCTCCTGGAGCTCCACCAGGTGTTCCTCGACATGGCCGTGGTGGTGGAGTCCC
AGGGGGAGCAGCTCGACGACATCGAGCGCCACGTCAACAGCGCCACCACCTACGTCCAGG
GCGGCAACAAGGAGCTACGCAAGGCCCGCGAGCACCAGCGCAGCAGCCGCAAGTGGCTCT
GCATCGGCATCATCATCCTGCTGCTCCTCGTCCTCCTCGTCATCGTGCCCATCGCCACCA
GCTTCAAGAGATCGTGAGCGCGCGGCCGAGGAGAAGCAGCTCATGTTGTTCAGAAAGGGT
TCGATCAATTGATCCAGACACTATGCAGTTGTGTCTCAATTCCGGTTTTTTTTTCGCTTT
CGTGTTCTCGATTCGTTCGTTAATTTCTGGCCGAATGTTTCTGTATCAATCAGGATTTAG
CTGATGATCATATAAAATACTCTACACCCGTATATTTGTTCCGTC

CDS

936 bp

>Os03t0736500-01 Syntaxin-related protein KNOLLE (Syntaxin 111) (AtSYP111).
ATGAACGACCTCATGACCAAGTCGTTCATGAGCTACGTCGACCTGAAGAAGGCGGCGATG
AAGGACCTGGAGGCGGGCGGGGATGgcgtggagctccccgaggtgggcgtcaccgacgag
cgcctcaaggggttcttccaggagacggaggcggtggaggaggagatggccgccatccgc
gacgcgctggCGAGGCTCAACGCCGCCAACGAGGAGGGCAAGTCGCTGCACCAGCCCGAC
GCCCTCCGCGCGCTCCGCGGCCGCGTCAACGCCGACATCATCGCCGTGCTCCGCCGCGCG
CGCGACATCCGCGCCAGGCTCGAGGCCATGGACCGCGCCAACGCGGCGCAGCGCAGGCTC
TCCGCGGGCTGCCGCGAGGGCACCCCGCTCGACCGCACCCGCACCGCGCTCACCGCCGCG
CTCCGGAAGAAGCTCAAGGACCTCATGCTCGACTTCCAGGCCCTGCGGCAGCGGATCATG
TCCGAGTACAAGGACACCGTCGAGCGCCGCTACTACACCCTCACCGGCGAGGTCCCCGAG
GAGGAGGTGATCGAGCGCATCATCTCCGAGGGACGCAGCGAGGAGCTCCTGTGCGCCGCC
GTGGCGGAGCACGGCAAGGGCGCGGTGCTGGCCACGGTGCACGAGATCCAGGACCGCCAC
GACGCCGCCCGCGAGGTGGAGCGCAGCCTCCTGGAGCTCCACCAGGTGTTCCTCGACATG
GCCGTGGTGGTGGAGTCCCAGGGGGAGCAGCTCGACGACATCGAGCGCCACGTCAACAGC
GCCACCACCTACGTCCAGGGCGGCAACAAGGAGCTACGCAAGGCCCGCGAGCACCAGCGC
AGCAGCCGCAAGTGGCTCTGCATCGGCATCATCATCCTGCTGCTCCTCGTCCTCCTCGTC
ATCGTGCCCATCGCCACCAGCTTCAAGAGATCGTGA

Protein

312 aa

>Os03t0736500-01 Syntaxin-related protein KNOLLE (Syntaxin 111) (AtSYP111).
MNDLMTKSFMSYVDLKKAAMKDLEAGGDGVELPEVGVTDERLKGFFQETEAVEEEMAAIR
DALARLNAANEEGKSLHQPDALRALRGRVNADIIAVLRRARDIRARLEAMDRANAAQRRL
SAGCREGTPLDRTRTALTAALRKKLKDLMLDFQALRQRIMSEYKDTVERRYYTLTGEVPE
EEVIERIISEGRSEELLCAAVAEHGKGAVLATVHEIQDRHDAAREVERSLLELHQVFLDM
AVVVESQGEQLDDIERHVNSATTYVQGGNKELRKAREHQRSSRKWLCIGIIILLLLVLLV
IVPIATSFKRS*

5'UTR

chr03:30192888..30192988 (+ strand) : 101 bp

CDS

chr03:30192989..30193924 (+ strand) : 936 bp

3'UTR

chr03:30193925..30194132 (+ strand) : 208 bp

FASTA

>Os03t0736500-01 class=Sequence position=chr03:30192888..30194132 (+ strand)
CTCCTCACAG ATCACCAGAT CCCCTTCGCC TTCGCCTTCG CCTCACCACC AAACCCTAGA GAAGCGAGAG AGAGGGAGAG
ATCTCCACGA GATTCGCCGC CATGAACGAC CTCATGACCA AGTCGTTCAT GAGCTACGTC GACCTGAAGA AGGCGGCGAT
GAAGGACCTG GAGGCGGGCG GGGATGgcgt ggagctcccc gaggtgggcg tcaccgacga gcgcctcaag gggttcttcc
aggagacgga ggcggtggag gaggagatgg ccgccatccg cgacgcgctg gCGAGGCTCA ACGCCGCCAA CGAGGAGGGC
AAGTCGCTGC ACCAGCCCGA CGCCCTCCGC GCGCTCCGCG GCCGCGTCAA CGCCGACATC ATCGCCGTGC TCCGCCGCGC
GCGCGACATC CGCGCCAGGC TCGAGGCCAT GGACCGCGCC AACGCGGCGC AGCGCAGGCT CTCCGCGGGC TGCCGCGAGG
GCACCCCGCT CGACCGCACC CGCACCGCGC TCACCGCCGC GCTCCGGAAG AAGCTCAAGG ACCTCATGCT CGACTTCCAG
GCCCTGCGGC AGCGGATCAT GTCCGAGTAC AAGGACACCG TCGAGCGCCG CTACTACACC CTCACCGGCG AGGTCCCCGA
GGAGGAGGTG ATCGAGCGCA TCATCTCCGA GGGACGCAGC GAGGAGCTCC TGTGCGCCGC CGTGGCGGAG CACGGCAAGG
GCGCGGTGCT GGCCACGGTG CACGAGATCC AGGACCGCCA CGACGCCGCC CGCGAGGTGG AGCGCAGCCT CCTGGAGCTC
CACCAGGTGT TCCTCGACAT GGCCGTGGTG GTGGAGTCCC AGGGGGAGCA GCTCGACGAC ATCGAGCGCC ACGTCAACAG
CGCCACCACC TACGTCCAGG GCGGCAACAA GGAGCTACGC AAGGCCCGCG AGCACCAGCG CAGCAGCCGC AAGTGGCTCT
GCATCGGCAT CATCATCCTG CTGCTCCTCG TCCTCCTCGT CATCGTGCCC ATCGCCACCA GCTTCAAGAG ATCGTGAGCG
CGCGGCCGAG GAGAAGCAGC TCATGTTGTT CAGAAAGGGT TCGATCAATT GATCCAGACA CTATGCAGTT GTGTCTCAAT
TCCGGTTTTT TTTTCGCTTT CGTGTTCTCG ATTCGTTCGT TAATTTCTGG CCGAATGTTT CTGTATCAAT CAGGATTTAG
CTGATGATCA TATAAAATAC TCTACACCCG TATATTTGTT CCGTC