Os03t0737000-03

Locus

Os03g0737000

Description

Similar to CBS domain containing protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCBSX4, OsCBSX4a, OsCBSX4b, OsCBSX4c, OsCBSX4d, OsCBSX4e, OsCBSX4f

Oryzabase Gene Name Synonym(s)

cystathionine b-synthase domain containing protein OsCBSX4, CBS domain containing protein OsCBSX4

Transcript Evidence

AK068510 (DDBJ, Best hit)

Protein Evidence

Q10D87 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Cystathionine beta-synthase, core (IPR000644)

Aldolase-type TIM barrel (IPR013785)

Full-length cDNA

J013152K18 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0737000-03)

Others

Oryzabase (10321)

Transcript

3164 bp

>Os03t0737000-03 Similar to CBS domain containing protein, expressed.
ATCATACCAAGTGTCCTCCTTCCTCCTCATCCTCCCCAACCACTGCATCCGGGTCGGCGT
CCTCCTCCTCCTCCTCCTCCTCGCAGGTAAAGCAGCATCCAAGCATCCTTTCCAATCCAT
GCTCAGAGTTGGAAGTAGAGCTGCTGCTGATGATGGTGTGTGGATCGGTGCTGGTTGGTT
TCTCGTTCTTGCTTGAGTGTGAGATGTGATGTTGATGTGCGTGTGTGTGGAGTCTGGACT
GGAAGGTTTCTTGAGTTCAGAGTGCAGATCAGAGAATCGTACTTTTGCTTTTTACAGTGT
GTTCTTGGTTTGCCCACACGATCTGTTCATCTTTTGTTTCTTTTGTTTTGCCTTTCATGA
ACAAACGACCACAGCTCTGCTTGCCTGCTACTGTCCTTCTCAGTTTGGCAAATGAAAGGA
TATTTTTTTTAGGGAAAGAAAGCGAAAATTACTAGTGCTAGAAAGCAGTGGCAAGTGAGA
ATAACACTTCTGCTTGATTGATTAGGTTAGGAGTTTATAGATAGTTCTTCCCTCTTGGTA
CTGTCAGTCTGTCACTGGTGTGTAAGTAGAGTGACAGTGTTGATGTTCTTCCTTGAGATA
AACGGCGATATCCTTTTATCACTTCCTGAGAGAGCACGGCACGCTTTACTCCCTTTTATT
CTGGAAATATTGTTCTCTTCCATGGGTTACAGTTTGTGTTTCGATACAGCTTTGCTTGCC
ATGATTTTTTTTCTGGCCACTTTTTTAGTTAGAGAAGCTAAAGAACTTACTTTTGGTTTC
GGGTTAGGCGTGCCGTAGATTCATATGCAATTCATGGTCCGCTTGTTTCTTTTGATTATT
GAGCTTGAGTGATTCGGTAACATCACAACAGTACACCCACATATCATGGACACATCAAGT
GCGTGTAGTTTATTTAGTATTTAGTGTTTTGAGTGGAGACGGCAATAGCTGGATTCTGTA
TTTGGTGGTGACTCCTTATTGGTTGATTGTGACCTAAATAAATATTATTGATTTGCTAAC
GAATGCTGGCAAACCTTTGCCCGTTTTTTCGCCTTGCACTTTCATGAACTAAATGATTCT
TGGAATCTAGGAGTATTAATTGGACAGACTCTTGGATTCTACTCTAGATCAATAAGGTTG
ACTACATTGATAGGGGATTCCCTGTAGAATACTGTGCATCAAAATGAATACCGATTAATA
GTCAATATGTAGACATGACCATTTCGCTGGTCATTCAACACATTTTGGTGCGTACATTGC
TTTGTTCTAGCAGTATTTTTGCTGACCAGTGTACAAAATGGTAGGCTAGAGCTATAATGC
TTTACATCCTTTTCATTGCATCAGCGCAGTGGAAATTAACTTCCACTTGACATAATGCTC
CCAGGCCCCATCAGGATTGGTGTGGGGTTGTTTATTTATGTGGAATAGTTTGAGAACTAT
ATTGTTTTTTAAGTAATTCCACTTGTACAGACTTTCTTGTTGCTTTCTTACCAGTCCTTT
ATACTGAAACTGATTGTCCGGTCATTCTAGCAGTCACCTGCATTACAACGGAAATTGATT
TGCAACAACTCTGTTTCGGACAAGCAAAAAAAAAAATCCATGGGAAGAGGAGCCCTTTTT
TCGTTTGAATTATTCCAAATACCAACTTATTTACTTGAAATCCAAAAAATCAGGAAGAAA
AAAGAGAGAGTAGCAAACAGTTTATTACACGAATGTCCAGTCTTTTCTTGCTGCTTTTTC
TGGTGCTTTTTTATTGATCAACTGCCATGATATAATTAGTAACTAGTCTCTTTGCCTTCA
ACAACAGCATCCGGACTTCCAGAGTTCTAGCCAGGCACATGACTTTGTTGGAGTCAAGTA
ATTGGTCATACCTTAATTTAGATTGATGAACTTTCGGTTGCTTTTGGTTCTTCTCTGTGT
TGTATTTGAGATAATTTTGCAGTATTGTTCAAATTTTAAACTCTTAAGTCATCCAAGACA
TCTTTATTCTCACGAGTTCTTTGCTATCTGTAGTTCTATATACTCTTTTATCATTAGCCA
AAAAAGAAGTGAAATAATAAGAAGTTATAAGTCAGATATTTTCTTTGTTCAAAATGGAGT
AATCATGTCTTTTGATATGTTTGATCTGACACAGAATGCAACGGGCAATTCAAGCTATCG
GGTCACATGGCAGTCTCCTCAAGTCTGCTGTTCTGCGACACATCAGTGCTCCAAAACCAT
CTATTTTACCTGCTGTATATTCACGCTCCATGTCAGTTTCATCTGCTCAAATAGAGGAGA
GTGGATTTGAGACTGCCACTGTGGCAGATATTTTGAAGTCTAAGGGGAAGAGTGCTGATG
GATCTTGGCTCTGGTGCACTACTGATGACTCTGTCTATGATGCTGTCAAATCTATGACGC
AACACAATGTTGGAGCTCTGGTGGTTGTTAAACCTGGACAGGATAAATCAATTGCTGGTA
TTGTTACTGAGAGAGATTACCTCAGGAAAATCATAGTGCAGGGACGATCTTCCAAGTCAA
CTAAAGTTGGAGACATCATGACTGAAGAGAACCAGCTGATCACGGTGAAGCCTGATACCA
GAGTCCTGCAAGCAATGCAGCTGATGACAGAGAAGCGCATCAGGCACATCCCGGTGATCG
ACGGCACGGGCATGGTTGGGATGGTCTCCATTGGAGACATTGTCCGCGCCGTGGTCAGCG
AGCACCGGGAAGAGCTGAACCGGCTCAACGCCTACATCCAGGGTGGCTACTAGGACGCCG
ACGTCGACGTTGGTCACTCGCTCCTGCCATTGAGGCTGTGCCTGTCTGAAAAAGACTCCC
TCTTCCAAATAACGCTCGCTCGGGATGATGACGAAATAGGCCGCGATTTTCCTGGAGAAA
TTGTTGCCGAATGTTTCTGCTTGTTCGCGTGTATTATATCAATCTGATGGTGGAAACGAA
CACCCAAATAAAATGAACCGTGTACACCGTCTTGTGCAGCAGCCTGCTGTTTGTGAATTG
TGGCAGGTTGTTGTTGAGACGAGTCTTGATGTTTAATTAGATGGATTTGCCGCTGTAGTT
TGGGAATCCTGGGCGTTTTCACAAGTCAGACGCTGAACATAAGCAAAGCCTCTGGCCATG
TTTGGGGATTGTTTGTGGAGTTTTTAACGGCTGATGCTTCTTTT

CDS

624 bp

>Os03t0737000-03 Similar to CBS domain containing protein, expressed.
CACAGAATGCAACGGGCAATTCAAGCTATCGGGTCACATGGCAGTCTCCTCAAGTCTGCT
GTTCTGCGACACATCAGTGCTCCAAAACCATCTATTTTACCTGCTGTATATTCACGCTCC
ATGTCAGTTTCATCTGCTCAAATAGAGGAGAGTGGATTTGAGACTGCCACTGTGGCAGAT
ATTTTGAAGTCTAAGGGGAAGAGTGCTGATGGATCTTGGCTCTGGTGCACTACTGATGAC
TCTGTCTATGATGCTGTCAAATCTATGACGCAACACAATGTTGGAGCTCTGGTGGTTGTT
AAACCTGGACAGGATAAATCAATTGCTGGTATTGTTACTGAGAGAGATTACCTCAGGAAA
ATCATAGTGCAGGGACGATCTTCCAAGTCAACTAAAGTTGGAGACATCATGACTGAAGAG
AACCAGCTGATCACGGTGAAGCCTGATACCAGAGTCCTGCAAGCAATGCAGCTGATGACA
GAGAAGCGCATCAGGCACATCCCGGTGATCGACGGCACGGGCATGGTTGGGATGGTCTCC
ATTGGAGACATTGTCCGCGCCGTGGTCAGCGAGCACCGGGAAGAGCTGAACCGGCTCAAC
GCCTACATCCAGGGTGGCTACTAG

Protein

208 aa

>Os03t0737000-03 Similar to CBS domain containing protein, expressed.
HRMQRAIQAIGSHGSLLKSAVLRHISAPKPSILPAVYSRSMSVSSAQIEESGFETATVAD
ILKSKGKSADGSWLWCTTDDSVYDAVKSMTQHNVGALVVVKPGQDKSIAGIVTERDYLRK
IIVQGRSSKSTKVGDIMTEENQLITVKPDTRVLQAMQLMTEKRIRHIPVIDGTGMVGMVS
IGDIVRAVVSEHREELNRLNAYIQGGY*

5'UTR

chr03:30208249..30210377 (- strand) : 2129 bp

CDS

chr03:30207985..30208248 (- strand) : 264 bp

chr03:30207827..30207908 (- strand) : 82 bp

chr03:30207381..30207454 (- strand) : 74 bp

chr03:30207071..30207131 (- strand) : 61 bp

chr03:30206834..30206976 (- strand) : 143 bp

3'UTR

chr03:30206423..30206833 (- strand) : 411 bp

FASTA

>Os03t0737000-03 class=Sequence position=chr03:30206423..30210377 (- strand)
ATCATACCAA GTGTCCTCCT TCCTCCTCAT CCTCCCCAAC CACTGCATCC GGGTCGGCGT CCTCCTCCTC CTCCTCCTCC
TCGCAGGTAA AGCAGCATCC AAGCATCCTT TCCAATCCAT GCTCAGAGTT GGAAGTAGAG CTGCTGCTGA TGATGGTGTG
TGGATCGGTG CTGGTTGGTT TCTCGTTCTT GCTTGAGTGT GAGATGTGAT GTTGATGTGC GTGTGTGTGG AGTCTGGACT
GGAAGGTTTC TTGAGTTCAG AGTGCAGATC AGAGAATCGT ACTTTTGCTT TTTACAGTGT GTTCTTGGTT TGCCCACACG
ATCTGTTCAT CTTTTGTTTC TTTTGTTTTG CCTTTCATGA ACAAACGACC ACAGCTCTGC TTGCCTGCTA CTGTCCTTCT
CAGTTTGGCA AATGAAAGGA TATTTTTTTT AGGGAAAGAA AGCGAAAATT ACTAGTGCTA GAAAGCAGTG GCAAGTGAGA
ATAACACTTC TGCTTGATTG ATTAGGTTAG GAGTTTATAG ATAGTTCTTC CCTCTTGGTA CTGTCAGTCT GTCACTGGTG
TGTAAGTAGA GTGACAGTGT TGATGTTCTT CCTTGAGATA AACGGCGATA TCCTTTTATC ACTTCCTGAG AGAGCACGGC
ACGCTTTACT CCCTTTTATT CTGGAAATAT TGTTCTCTTC CATGGGTTAC AGTTTGTGTT TCGATACAGC TTTGCTTGCC
ATGATTTTTT TTCTGGCCAC TTTTTTAGTT AGAGAAGCTA AAGAACTTAC TTTTGGTTTC GGGTTAGGCG TGCCGTAGAT
TCATATGCAA TTCATGGTCC GCTTGTTTCT TTTGATTATT GAGCTTGAGT GATTCGGTAA CATCACAACA GTACACCCAC
ATATCATGGA CACATCAAGT GCGTGTAGTT TATTTAGTAT TTAGTGTTTT GAGTGGAGAC GGCAATAGCT GGATTCTGTA
TTTGGTGGTG ACTCCTTATT GGTTGATTGT GACCTAAATA AATATTATTG ATTTGCTAAC GAATGCTGGC AAACCTTTGC
CCGTTTTTTC GCCTTGCACT TTCATGAACT AAATGATTCT TGGAATCTAG GAGTATTAAT TGGACAGACT CTTGGATTCT
ACTCTAGATC AATAAGGTTG ACTACATTGA TAGGGGATTC CCTGTAGAAT ACTGTGCATC AAAATGAATA CCGATTAATA
GTCAATATGT AGACATGACC ATTTCGCTGG TCATTCAACA CATTTTGGTG CGTACATTGC TTTGTTCTAG CAGTATTTTT
GCTGACCAGT GTACAAAATG GTAGGCTAGA GCTATAATGC TTTACATCCT TTTCATTGCA TCAGCGCAGT GGAAATTAAC
TTCCACTTGA CATAATGCTC CCAGGCCCCA TCAGGATTGG TGTGGGGTTG TTTATTTATG TGGAATAGTT TGAGAACTAT
ATTGTTTTTT AAGTAATTCC ACTTGTACAG ACTTTCTTGT TGCTTTCTTA CCAGTCCTTT ATACTGAAAC TGATTGTCCG
GTCATTCTAG CAGTCACCTG CATTACAACG GAAATTGATT TGCAACAACT CTGTTTCGGA CAAGCAAAAA AAAAAATCCA
TGGGAAGAGG AGCCCTTTTT TCGTTTGAAT TATTCCAAAT ACCAACTTAT TTACTTGAAA TCCAAAAAAT CAGGAAGAAA
AAAGAGAGAG TAGCAAACAG TTTATTACAC GAATGTCCAG TCTTTTCTTG CTGCTTTTTC TGGTGCTTTT TTATTGATCA
ACTGCCATGA TATAATTAGT AACTAGTCTC TTTGCCTTCA ACAACAGCAT CCGGACTTCC AGAGTTCTAG CCAGGCACAT
GACTTTGTTG GAGTCAAGTA ATTGGTCATA CCTTAATTTA GATTGATGAA CTTTCGGTTG CTTTTGGTTC TTCTCTGTGT
TGTATTTGAG ATAATTTTGC AGTATTGTTC AAATTTTAAA CTCTTAAGTC ATCCAAGACA TCTTTATTCT CACGAGTTCT
TTGCTATCTG TAGTTCTATA TACTCTTTTA TCATTAGCCA AAAAAGAAGT GAAATAATAA GAAGTTATAA GTCAGATATT
TTCTTTGTTC AAAATGGAGT AATCATGTCT TTTGATATGT TTGATCTGAC ACAGAATGCA ACGGGCAATT CAAGCTATCG
GGTCACATGG CAGTCTCCTC AAGTCTGCTG TTCTGCGACA CATCAGTGCT CCAAAACCAT CTATTTTACC TGCTGTATAT
TCACGCTCCA TGTCAGTTTC ATCTGCTCAA ATAGAGGAGA GTGGATTTGA GACTGCCACT GTGGCAGATA TTTTGAAGTC
TAAGGGGAAG AGTGCTGATG GATCTTGGCT CTGGTGCACT ACTGATGACT CTGTCTATGA TGCTGTCAAA TCTGTATGTG
TCTTCTCCTT CTCATATTAC CTCTTAAGTG AACAGTTATG CTTCAACATG ATAAAGTTTC TTCTATCAGA TGACGCAACA
CAATGTTGGA GCTCTGGTGG TTGTTAAACC TGGACAGGAT AAATCAATTG CTGGTATTGT TACTGAGAGA GGTAACAAGC
CACCATGTGT ATTTATTTTG TCTCTAGCCA CTGGGTCTGT AATTCAAAAA CACAATCATA TGCTAGAAGA CAGACTATTG
CTTAATTCAG TTGTAAAAAA GAGATACTAG TGCATGAAGC TGGCTTTAGA AAAGAAAGAG TTTAAACAGT ACATGCAAAG
TTACATTGAA ATGTTTGGAC TAATAAAGAA GATAAAAAAC AATCAATACA TGGTCAGACA GACAGACACA GTGTTCATGT
GAATGGTACC AACCCTTACG GTCAAAAACA CAACAGAAAA CCTTTACTTG TTTATAAACA TGATTGGCTT AGAAAGTACT
TGTGTTGCGT AACTAACACC TGAATCATGC TCTATGTTTC CAGATTACCT CAGGAAAATC ATAGTGCAGG GACGATCTTC
CAAGTCAACT AAAGTTGGAG ACATCATGAC TGAAGAGGTA CACCCCTTGT TATGCTAATT TTCTTTTAGG CTGTATCCGT
CGGTCATGGT GGTGGAAATA CACCCTGAAT CTGATTAGTA CAGAGGCTAA GTCGTAAGCA TGAAAAAGTT AGTCAGTTGA
CAAACTTGGT TGCCAAAACT ACTAACATTC TATACTATGG TTTTAGTTTT AACAAAATAT TAAAATGCGA CCAGAGTATT
GACTGTTCTA AAACGAACGT TCATTGACAA AACATCATTT CGACAGAACC AGCTGATCAC GGTGAAGCCT GATACCAGAG
TCCTGCAAGC AATGCAGCTG ATGACAGGTA AAACATCTTT GATCTTTCTC CGATTCAGTA CCTGAAACAG AAAGTTCAGA
TAGCAATTGC TAACACCGGT GTTGCCGATC TCCGTGTGCA GAGAAGCGCA TCAGGCACAT CCCGGTGATC GACGGCACGG
GCATGGTTGG GATGGTCTCC ATTGGAGACA TTGTCCGCGC CGTGGTCAGC GAGCACCGGG AAGAGCTGAA CCGGCTCAAC
GCCTACATCC AGGGTGGCTA CTAGGACGCC GACGTCGACG TTGGTCACTC GCTCCTGCCA TTGAGGCTGT GCCTGTCTGA
AAAAGACTCC CTCTTCCAAA TAACGCTCGC TCGGGATGAT GACGAAATAG GCCGCGATTT TCCTGGAGAA ATTGTTGCCG
AATGTTTCTG CTTGTTCGCG TGTATTATAT CAATCTGATG GTGGAAACGA ACACCCAAAT AAAATGAACC GTGTACACCG
TCTTGTGCAG CAGCCTGCTG TTTGTGAATT GTGGCAGGTT GTTGTTGAGA CGAGTCTTGA TGTTTAATTA GATGGATTTG
CCGCTGTAGT TTGGGAATCC TGGGCGTTTT CACAAGTCAG ACGCTGAACA TAAGCAAAGC CTCTGGCCAT GTTTGGGGAT
TGTTTGTGGA GTTTTTAACG GCTGATGCTT CTTTT

Locus: Os03g0737000

Loading...

Locus: Os03g0737000

Loading...