Os03t0741100-01

Locus

Os03g0741100

Description

Basic helix-loop-helix transcription factor, Drought tolerance

RAP-DB Gene Symbol Synonym(s)

OsbHLH148

RAP-DB Gene Name Synonym(s)

basic helix-loop-helix protein 148

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsbHLH148, bHLH148

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 148

Transcript Evidence

AK071734

Protein Evidence

Q75KV9

Literature

PMID: 21332845

Note

Manual Curation

June 11, 2015

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Full-length cDNA

J023108N23 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0741100-01)

RiceXPro (AK071734)

Others

Oryzabase (9485)

KEGG (Os03t0741100-01)

Transcript

1181 bp

>Os03t0741100-01 Basic helix-loop-helix transcription factor, Drought tolerance
GGAAACCATCGCCAACCATCACATCTGATCGAGAACAAGAAGAAGAAGAAGAAGAAGCAA
GAACAGCAAGAGGAAGAGATGCAAATGGAGTCGTACTACGGCGCGTTCCACGCCGACGAG
GCCGCGTTCTTCTTCCCCCACCACGTGCCGGCGTCGCCGGAGCTGCCGTTCGGCCTCATT
GCGTCGCCGGAGCCGGAGCCGGAGCcggagcaggcggcggcggaggcgaggcagagcgcg
ttccaggagtacggcggcgcggtgcacgccggagcgccggcggcggcgggggctgtcacc
accggtgggacgaacatccaccggagggtgatggacgtgctgggcaggatgggcggcggc
ggcggcgggggggagaagggggagggtgaggagatggaggaggaggaggaggtgccgcag
cggcggcggcgcgggcagggcgccgacgtggagagcagccgcggTTTCCGCCACATGATG
CGCGAGCGCCAGCGCCGCGAGAAGCTCAGCCAGAGCTACGCCGACCTCTACGCCATGGTC
TCCTCTCGCTCCAAGGGGGACAAGAACTCGATCGTGCAGTCGGCGGCGATCTACATCCAC
GAGCTGAAGGTCGCGAGGGACCAGCTGCAGAGGAGGAACGAGGAGCTGAAGGCCCAGATC
ATGGGCCACGACGAGCAGCAGCCGTGCGTCACGGTGCAGTTCGAGGTCGACGAGCCGTCG
TCGTCGATCGACTCCATGATCGCCGCGCTCCGGCGGCTCAAGGGCATGAGCGTCAAGGCG
CGCGGGATCCGGTCGAGCATGTCCGGGAACAGGCTGTGGACGGAGATGAACGTCGAGACC
ACGATTGCGGCTTGTGAAGTGGAAAAGGCAGTGGAAGAGGCTCTCAAGGAAGTAGAGAGG
AACCAGCCTGACAGCGATGCCCCATTTCCTGGAAGCAAAGGCTGGACACAGACATCTCAT
GTGCAAAATGTGTTTTGATCGGTTTTGAAACATGATCCTGCTGGGACCCCCATTTGTTCA
TTTTTTTAAAAGCTTGTGATGGAGCAAGTGGAAAAAAAATCTCCATATCTCCTTGTCAAT
GTACCTTTTTTTTGTCCATGTAGATACAATCATACAAATAATAGCTTCCTCTCTTTTCTA
CAAGGAAAAAAGAAAGAGAAGAGTACAAAAAAGATTTAAGC

CDS

900 bp

>Os03t0741100-01 Basic helix-loop-helix transcription factor, Drought tolerance
ATGCAAATGGAGTCGTACTACGGCGCGTTCCACGCCGACGAGGCCGCGTTCTTCTTCCCC
CACCACGTGCCGGCGTCGCCGGAGCTGCCGTTCGGCCTCATTGCGTCGCCGGAGCCGGAG
CCGGAGCcggagcaggcggcggcggaggcgaggcagagcgcgttccaggagtacggcggc
gcggtgcacgccggagcgccggcggcggcgggggctgtcaccaccggtgggacgaacatc
caccggagggtgatggacgtgctgggcaggatgggcggcggcggcggcgggggggagaag
ggggagggtgaggagatggaggaggaggaggaggtgccgcagcggcggcggcgcgggcag
ggcgccgacgtggagagcagccgcggTTTCCGCCACATGATGCGCGAGCGCCAGCGCCGC
GAGAAGCTCAGCCAGAGCTACGCCGACCTCTACGCCATGGTCTCCTCTCGCTCCAAGGGG
GACAAGAACTCGATCGTGCAGTCGGCGGCGATCTACATCCACGAGCTGAAGGTCGCGAGG
GACCAGCTGCAGAGGAGGAACGAGGAGCTGAAGGCCCAGATCATGGGCCACGACGAGCAG
CAGCCGTGCGTCACGGTGCAGTTCGAGGTCGACGAGCCGTCGTCGTCGATCGACTCCATG
ATCGCCGCGCTCCGGCGGCTCAAGGGCATGAGCGTCAAGGCGCGCGGGATCCGGTCGAGC
ATGTCCGGGAACAGGCTGTGGACGGAGATGAACGTCGAGACCACGATTGCGGCTTGTGAA
GTGGAAAAGGCAGTGGAAGAGGCTCTCAAGGAAGTAGAGAGGAACCAGCCTGACAGCGAT
GCCCCATTTCCTGGAAGCAAAGGCTGGACACAGACATCTCATGTGCAAAATGTGTTTTGA

Protein

300 aa

>Os03t0741100-01 Basic helix-loop-helix transcription factor, Drought tolerance
MQMESYYGAFHADEAAFFFPHHVPASPELPFGLIASPEPEPEPEQAAAEARQSAFQEYGG
AVHAGAPAAAGAVTTGGTNIHRRVMDVLGRMGGGGGGGEKGEGEEMEEEEEVPQRRRRGQ
GADVESSRGFRHMMRERQRREKLSQSYADLYAMVSSRSKGDKNSIVQSAAIYIHELKVAR
DQLQRRNEELKAQIMGHDEQQPCVTVQFEVDEPSSSIDSMIAALRRLKGMSVKARGIRSS
MSGNRLWTEMNVETTIAACEVEKAVEEALKEVERNQPDSDAPFPGSKGWTQTSHVQNVF*

5'UTR

chr03:30406830..30406907 (+ strand) : 78 bp

CDS

chr03:30406908..30407384 (+ strand) : 477 bp

chr03:30407752..30408039 (+ strand) : 288 bp

chr03:30409005..30409139 (+ strand) : 135 bp

3'UTR

chr03:30409140..30409342 (+ strand) : 203 bp

FASTA

>Os03t0741100-01 class=Sequence position=chr03:30406830..30409342 (+ strand)
GGAAACCATC GCCAACCATC ACATCTGATC GAGAACAAGA AGAAGAAGAA GAAGAAGCAA GAACAGCAAG AGGAAGAGAT
GCAAATGGAG TCGTACTACG GCGCGTTCCA CGCCGACGAG GCCGCGTTCT TCTTCCCCCA CCACGTGCCG GCGTCGCCGG
AGCTGCCGTT CGGCCTCATT GCGTCGCCGG AGCCGGAGCC GGAGCcggag caggcggcgg cggaggcgag gcagagcgcg
ttccaggagt acggcggcgc ggtgcacgcc ggagcgccgg cggcggcggg ggctgtcacc accggtggga cgaacatcca
ccggagggtg atggacgtgc tgggcaggat gggcggcggc ggcggcgggg gggagaaggg ggagggtgag gagatggagg
aggaggagga ggtgccgcag cggcggcggc gcgggcaggg cgccgacgtg gagagcagcc gcggTTTCCG CCACATGATG
CGCGAGCGCC AGCGCCGCGA GAAGCTCAGC CAGAGCTACG CCGACCTCTA CGCCATGGTC TCCTCTCGCT CCAAGGTTCG
TCGGCCTCCT CTGCTCACAG CCTAAGCTTA TCACTCTCAC TTAGTACTCT ACTTCACTTC GCCGCTCACT TCATTTCAAG
CTCCATTTCA TCTTTCACCT AGATTCCATC GAGAAATGCC TAATGTAGAC TGCTAATTTG GCCTTCTTTA AGCTCAGATT
TTCGTTTACC ATCGCATTGT CCCATTTCAT TGGCTTCAAT TTGCCTCTTC TTGATTTCCC CAATGTTAAT CTGAAATTCA
GAGCATCTTC AGCTCAAACC AATTCTGTTC AGCTTCAGAA TGTTCGAAAT CCCCCTTTAA TACCTCTTAA ATGGAGTGTT
TACCAAAATC GGGCTGACAA AAAACCGTTC GTGTCACTGC AGGGGGACAA GAACTCGATC GTGCAGTCGG CGGCGATCTA
CATCCACGAG CTGAAGGTCG CGAGGGACCA GCTGCAGAGG AGGAACGAGG AGCTGAAGGC CCAGATCATG GGCCACGACG
AGCAGCAGCC GTGCGTCACG GTGCAGTTCG AGGTCGACGA GCCGTCGTCG TCGATCGACT CCATGATCGC CGCGCTCCGG
CGGCTCAAGG GCATGAGCGT CAAGGCGCGC GGGATCCGGT CGAGCATGTC CGGGAACAGG CTGTGGACGG AGATGAACGT
CGAGACCACG GTGAGAGCTC TCTCTCTCTC TCTCTCTCTC TCTCCCCCCC CCCCCCCCCC CCCCCCCCCC CCCCCCCCCC
CCCTTGGCTT GCAATTCTTG AAAATTTTTG CATTTTTTCC CCTCTGAACT TAGCCTACCT GCCTTGTTGA CAGTAACTGT
CAGAGTTTTA ATTAGGTTAG GAAAGATGCA GCAGTTCGTC TCCTACAAGA TTAGCCTCAT TTTCGTGTTT TATCAATACA
CTGTATCTTG CCTTGGATAG CTACGGATTA GATTGTTACG TACAGTAGTA GATAGGAAAC CGTAGTGGCA ACGGGATAAC
TGGATAAGGA TGAAGAGTTC TAATCAACTT CAGAAATGGA AGATGGAAGC ATATTGGTTG GGAGAATTTG GGCTATTTTT
TTTTCGAATA AGAAGAATTT GGGCTAAATT AGAGAAGCAT CAGAGTAACG TTTCCGAAGG AAAAGATTAG TGCAGTAATT
TTGCTGAACT ATTTTATATC CTGTCCACTT GAGGTCAAGA TGCAGGAATT CCACTCGAAA CCCCCCAATT TGACATTAGT
CAACCGTGTC AAGAGTTCTT GTCGAATCTT TTGGTTTATG CATAAATCAT TTAGCAGATC CTCAACCCCA AGACCCCAAT
TACAAATAGC TGTAATTAGA GGTTTAATTA ATCAGCAACT GTTGTTAGTT AGCACTGGTC ATCCAACTGC CAAATCAATC
TTTCCTCAAA AGATTATTAC AAGTAGTTCA CAAACATCCA AACATGATCT TTCAAAAGGA AACATCCAAA TTCCAAACAG
CCATACCATA TTTTATACTA CAGAGCAACA ATCGGGGCCA ATTACAGTCC ATGCCTATCC AATATTAAAC TGAAAAAGTT
TATTATAATT ATAACACTAG CAGTTGATTA ATAATAGTAA GCCAATTGTA CACTCTAACT AACGACGTTT AATTTCGCAT
GTGTCATTTT CACAGATTGC GGCTTGTGAA GTGGAAAAGG CAGTGGAAGA GGCTCTCAAG GAAGTAGAGA GGAACCAGCC
TGACAGCGAT GCCCCATTTC CTGGAAGCAA AGGCTGGACA CAGACATCTC ATGTGCAAAA TGTGTTTTGA TCGGTTTTGA
AACATGATCC TGCTGGGACC CCCATTTGTT CATTTTTTTA AAAGCTTGTG ATGGAGCAAG TGGAAAAAAA ATCTCCATAT
CTCCTTGTCA ATGTACCTTT TTTTTGTCCA TGTAGATACA ATCATACAAA TAATAGCTTC CTCTCTTTTC TACAAGGAAA
AAAGAAAGAG AAGAGTACAA AAAAGATTTA AGC

Locus: Os03g0741100

Loading...

Locus: Os03g0741100

Loading...