Os03t0746500-02

Locus

Os03g0746500

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSUV3, SUV3

Oryzabase Gene Name Synonym(s)

SUV3 helicase, suppressor of Var 3

Transcript Evidence

AK058367 (DDBJ, Best hit)

Protein Evidence

NP_193215.2 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: helicase activity (GO:0004386)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Helicase, C-terminal (IPR001650)

Full-length cDNA

001-014-G01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0746500-02)

Others

Oryzabase (13479)

KEGG (Os03t0746500-02)

Transcript

344 bp

>Os03t0746500-02 Similar to predicted protein.
ATGTTTGTGGTGACCCAGCTGTGGTTCCTCTCATTCAGCGAATTCTCGAACCTACTGGTG
ATGTGGTTACGGTCCAATATTATGAGAGGCTATCTCCATTGGTTCCTCTGAAGACTACTC
TCGGGTCTTTCTCTAACATTAAGGCAGGGGATTGCGTTGTAACGTTCTCACGACGATCTA
TCTATATGCTTAAGAGAAGAATTGAAATGGGGGGTAAGCATCTTTGTTCTGTAGTCTATG
GCTCATTGCCACCAGAAACTCGAACAAAACAGGCGACAATGTTCAATGATCAAGATAGTA
ACCTTAATGTGTTAGTGGCTAGTGATGCTATTGGAATGGGTCTT

CDS

342 bp

>Os03t0746500-02 Similar to predicted protein.
GTTTGTGGTGACCCAGCTGTGGTTCCTCTCATTCAGCGAATTCTCGAACCTACTGGTGAT
GTGGTTACGGTCCAATATTATGAGAGGCTATCTCCATTGGTTCCTCTGAAGACTACTCTC
GGGTCTTTCTCTAACATTAAGGCAGGGGATTGCGTTGTAACGTTCTCACGACGATCTATC
TATATGCTTAAGAGAAGAATTGAAATGGGGGGTAAGCATCTTTGTTCTGTAGTCTATGGC
TCATTGCCACCAGAAACTCGAACAAAACAGGCGACAATGTTCAATGATCAAGATAGTAAC
CTTAATGTGTTAGTGGCTAGTGATGCTATTGGAATGGGTCTT

Protein

114 aa

>Os03t0746500-02 Similar to predicted protein.
VCGDPAVVPLIQRILEPTGDVVTVQYYERLSPLVPLKTTLGSFSNIKAGDCVVTFSRRSI
YMLKRRIEMGGKHLCSVVYGSLPPETRTKQATMFNDQDSNLNVLVASDAIGMGL

5'UTR

chr03:30687348..30687349 (- strand) : 2 bp

CDS

chr03:30687279..30687347 (- strand) : 69 bp

chr03:30686529..30686651 (- strand) : 123 bp

chr03:30685293..30685370 (- strand) : 78 bp

chr03:30684690..30684761 (- strand) : 72 bp

FASTA

>Os03t0746500-02 class=Sequence position=chr03:30684690..30687349 (- strand)
ATGTTTGTGG TGACCCAGCT GTGGTTCCTC TCATTCAGCG AATTCTCGAA CCTACTGGTG ATGTGGTTAC GGTAATTTCG
TTGAAACTCA CATAGTTAAA TTGAAGTGTA TTAATATGAC TCTGCCAGAA TGATGTTAGT TGCAAAGTTA GATTTGTTGA
CATTGGTGAA GACATTAGGT TTTGTGGATA ACTTAGATGA TGTAATTACC TAGTTTGGGA TGAAACAGTA ATACTAAATC
GCATGTTCTT GCAAGTGTAA GTTTTTTTTT ACTGTTTTCA AAGCTCCATG CTTAATATGT TTCAACTCAT TCCATTTTAA
CTTAAGATAC ACAATGATTT TATGGATTAT CATTGGTGGA TAGCATCAGC AATCCTGTAA CCTCTGTTAC TCAACTTATC
CTTAGCCACA CCAATTTGAG GTCCCGTCCA ACAATTTAGA TTGCACCCCT GGATAGTAAC ACTACTTCTG GACCTCCATC
TGAGAAAGTA ATGTGCAGGC ATGATGTCAT ATATATCTGT CTTTTGTTGG TGATTAGCTG ATGTTTTGTA TTTGCAGATA
ATATTCCAAG TGAACTCGAG AAACTGTTTC TTCTCAATAG AATTTGTTGA GCTGTCTAAT GTTTATTTTG GTGTTAGTAC
TGATACACGC ATCATGTCGT CAAATATTCC GATTTGCTGG CTGTATGTCT CTATGCAGGT CCAATATTAT GAGAGGCTAT
CTCCATTGGT TCCTCTGAAG ACTACTCTCG GGTCTTTCTC TAACATTAAG GCAGGGGATT GCGTTGTAAC GTTCTCACGA
CGATCTATCT ATATGCTTAA GGTTGGCATT CTTCAGATAA CTGTTGCAGA ATATACTGAA ATAATATCTA TCTGACCTGT
GTCCTGCAAT TAAAAGAGTA ACCAATAGAT ATCCCCTGCA AATTGTTGCC AGAAAATGTA AATAATAAGC TGAGAAAGTC
TCATTATTTT TTTTTGGTGA AAGAGAAATG ATCCAAATGC CATGTTTGTT AAACCTATCA TCGTAACTTG ATCTTTACCT
GTAAATTTTG AAACAACAAA CTCTCACCAG CATAACAACA CACCCCTCTG GCCTCTGCAT ACCCTCACGT GTATCTGGTA
CTCCACTAAC TTTATCATTT CACTTTTTTA TTCTCTCCTT CAAAGGGGGG GGGGATCACT CTATTGACTT AAGAAATGGG
ACATATTTCT CGCTATACAC TTAAACTCTT TGAATTTTGA TTCACAACAC TACAGTACTA TACTAGTATG GTTGGCAGTG
AAGGGTACTA GATAGCCCCC ATTACAGAAA TGATGAAAAG ACAAGGGAAA ACTATGTACG AACCTGTAAA GCTACTTAAG
TAATGCAACT ATGTACGGAA GATGTAGGCA TGTAACAGGG ACTAGGGAGA GCTGTGTTGT AGTAGTCAAT ATGATAATTA
CATCATGTTG TGAGAGCAGC GATAGCTTTG TAGCATGTTT TGACAGGTTG GCTAGTCCAT CGATAATTTA CTTTCTGTTT
TACATAAATG CAAGTTGAAA TCTATTAAGT CATCTAATCA TGTTTCTTTT TGCTTTTCTT CTCATGGTAT TTATTGAATT
TAACACTCCA ATCGAAAGAC TGGATATAAA GATTGCAAAT CCATGATATG AAAAATATGA ATCAATTAAG TTAGCTTAGC
CAGGGGCAGA TCAAATACAC AAGGATCAGA GTGCAGTGAC CATCATGTCT GCTGCACAAA CCCAAAAAGA TTATGCTCAC
TGTGACATTA CAAATCATTG TTGATTTATA CCCATGGTGG GACCCTGATA ACTTGCTGCC CTAGATCTGC ACTTGAATTA
AGCGACTGCA AACTAAGATA CATAATGTAA TGTATCAAAG CATCCTCATG TTGTGATTAT TACGAAAATT AATCATCTAG
CATATGAAGT AATATATGAA AGCTCAACTA CATTTCTTAT ATTTAAAATG TCCGTGCAGA GAAGAATTGA AATGGGGGGT
AAGCATCTTT GTTCTGTAGT CTATGGCTCA TTGCCACCAG AAACTCGAAC AAAACAGGTA CTTCCCTCAC TTGGTTATCT
GCTACTACAC CATTGTAGTT GATGCCTTGT TCTCACGTCT CTAGGTCCTT ATCTAATTAA AATTTACAGC TAAAGCACCA
AACGTTTCAT TTTTAATATA TTAACATGTA TATGCCATGT TTTGCTTGGC TTATGCTCAA TATATTTATA TTTTAAAATT
CCATCTTGCT GATTTTCTTC CATTAATAAA GTTTATTTGG TCTCTCATAT CTGAGTCACA TGATTGTCTG GATAATGTTT
TGTACAATGA TTAAAGTCAG TAAAATTAGC GGTGCAGAAG GATTAGAATT TTCTGTTTAA TGTTTGTGAG ATGAACTTTC
AGCTAGCAAT TTGTTGATTA ATACCCCGTA ACAGTAAAGC ACAACCAACC ACAAATTTTA GCTTGAATTT CAAGAAATCG
GTAGTTATGG TTGTAGGAGG CAAAACTTCT CTTGGCATGT TGTGCTTTAT TCTTGATGAT GCTGTGATGA TTTGAAAAAG
TTGATAAATC TATTCCCTGA GCTTGCAGGC GACAATGTTC AATGATCAAG ATAGTAACCT TAATGTGTTA GTGGCTAGTG
ATGCTATTGG AATGGGTCTT 

Locus: Os03g0746500

Loading...

Locus: Os03g0746500

Loading...