Os03t0754900-01

Locus

Os03g0754900

Description

Similar to Cleavage stimulation factor, 50 kDa subunit.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-93

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK101437 (DDBJ, Best hit)

Protein Evidence

B4FBI9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

Full-length cDNA

J033039C05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0754900-01)

RiceXPro (AK101437)

Others

Oryzabase (10774)

KEGG (Os03t0754900-01)

Transcript

3810 bp

>Os03t0754900-01 Similar to Cleavage stimulation factor, 50 kDa subunit.
GGTCAGTCCAGTAGCGGTTCGTCAGTCCAGACCAGTTCCTAGCTCCGAACAGAGTCCTTC
TCCGAAGTGCGAACTCGCTGCAAGCCGAATCCGCCGCGCCGCCACACGGAGACGAGAGGG
AGAGGTCGAGAGGGAGAGGGCGAGGGCGAGATGGACGCGGCGGTGCAGGAGGCGAAGCTG
CTGCGCCAGGTGAACGCCCTCATCGTGGCGCACCTCCGCGACCACAACCTCACGCAGGCT
GCCGCCGCCGTCGCCGCCGCCACCATGACGCCCCTCGCCCCGCCCGAGCCCGACGGCGAC
GACTCCGTCCCCGCCAACCAGCTCCTCCGCCTCGTCGCCAAGGGCCTCGCGGTGGAGCGG
GAGGAGACGGGGAGGGGAGGAGGGGCGTTCGACTCTGCCGCCGCCGCCGCTGGATACGGT
GGATTGTTGCCGCCGCTCGGCACCAATGCCGTGGATTTCAGCACGCAGGATGTTAAGGGC
TCATCCAAGAGCTTCCCCAAGCACGAGGCCAGGCACGTATCTGATCACAAGAATGTTGTC
CGATGTGCAAAATTTAGTCCTGATGGGAAATATTTTGCATCCGGGAGTGGTGACACATCA
ATTAAGTTCTTCGAGGTTGCTAAAATAAAGCAGATGATGCTAGGGGATTCCAAAGATGGC
CCTGTCCGTCCTGTGATCCGTACTTTTTACGATCACACGCAGCCCATCAATGATCTTGAT
TTTCATCCTGAGAGCCCCATACTGATATCTGCAGCAAAAGACAATACAATAAGGTTCTTC
GACTTCTCAAAAACTGTTGCAAGGAAAGCATTCAGAGTTATTCAGGACACTCACAATGTT
AGATCCGTATGTTTTCATCCTTGTGGGGATTACCTTTTAGCAGGTAGTACTATTATCCTT
TCACCATATGGATTTTACCTGTAAACTTGCTCTGTTGCTCTGGTTATGAGGTTGTGGTAT
TAATTTGGTTAATACGAACTTTTCTTAGCCTTTCTTTTTTTGGACCAAAGATAAATCAGA
TGATCGATCCAGCTTTACTGAAAAGCCAACAGAGTCTTACAGCAGAAGACAAAAGATAGC
AGGTGGATTTTCCAGCTTACAAGCATGAACACTGAGCCAAAACTACCCACATCTAGACTG
AAGAACTACATAAACACATCACCACTCCTTTCAGTTTAGTTGAAACTCCACCAGCTAGAT
CAGACAGCTATCAAACATCACATCTGCTGCACAATCATATGTCTTCAGGCAAAATGTCCC
TAGGCTTCAATTCATTGAGTTTTGCCATGATACTACTGCACCACTTGTCCACCCGCTCGT
GATCATTGTCCTTTTGAAGCCTTTTCCAACACTAAAAAAGAAAATAAGATAAACTTATAA
CCCCACATGCAGTGGAGATTTAACTCGTATCCCTTCAAAAACATAGTTGTTTCTGGTCAT
CCACAAAGACCAACAAACCCCTTCAAGCAAGACAATTCTATTTATCTGTTTAGCACTACA
TCTGTTTATGTTAAGGATATCCTCTATGGTGCGAAGCAAGACATTTAGCTTACATACATC
CCTCACAGCATTCCAAACATAAGTTCTAAAGGACAATCAAACAGAATGTGATTAGTAGTT
TCTCTTTTCTTACACAGTTTGCAAAAGTTTTAGTCAATTTCTCTGATACCAGATGTTATG
TGGTAGGATGAATTGGGGTGCTCGACGGGAAGGCGAGGCTGCTGCAGCCTTGCCGCCCCG
Gagcctaggtgaggccgaacagagaagagtggagactagagataggtttaacttctttct
tgattaattccaaatgactacggtgcctctccttatatagagccagctccTAACAAACAT
CCTAACAACCTTATCTAATAGAGCCTAACAACCTTATCTTATAATGAGAGGGGCTGAGTT
CTGCCCATAACATGTGCTCATTTTCGTCCTTCTGCCATGTGGTGTCCCATGTGGACTTGT
AGGGTCAGCACCTTCTTTCCAATTTAGACTATGCAAGTGACTGAAATGCGTGCTTTGCAT
CACCCGAAAAAACAAATAATGAACTGCATAGGGTCATCTTACATCGATAGTAATAAAAAT
TAGGGCAATGCAGTTACTTTATATAGTTTGTTGCATTTGAGGGCCCTGGATATTGTCTAC
CCGAACCCTGGATATTACCTGCCTGAGACCATCTGTGATGTCATAAGAGGCATTACCACT
AAAGCCTTTCTTTTGTCAAATTTTATTTTGTGCTGATGAACCCATAGTACCTACATTTGA
AGTTGGTTTCATATCATACCTTTTTATTGTATTTGATGTGATTGTGAAGTATATAACTGG
TCAATGTGCTTTTTGGTATTATCTGGCAAACTCTTTTAATTTATTGTTGAGTTTTAGCTT
GCGTACTCATTAGTACTAAGCATGTCTAGATTGCTAAAAACTTCTTATGCAGTGGTTTCT
TGTTTTCTAATGAAAATGAGGAACCAGGGTCTAGGTCCTTCATTCTAAAAACTCTTAATT
TATTTGACTAAAACTTTTTGGAGTTCTAGACTGAGGATTTCGATTTTGTTGTGGAATCAG
GCATTCTTTGCTTCTTTCATTTGATGTAATCCACCCCCCCCCCCAAGTGAAGACGCTCAT
ATGAATATTGCTAACAAACTGATAAAGATGATAACACAAATATGCTATCCATTAGCTGTT
TTGATCATGCAATTGATTAAGATAATTTGGACAGTGCCATCCTGACCTGACAAGCAGGCT
GCTGCCCCTTAGTGCGCACGAGCTGCTCCCGATGCACCTTCTGTGCACAGACTTATGATT
CCACCTGATTCCTTGCAAAACAGAGAGCTCAGCACGTGCTATTGGTGGCCCAGTCAGCCA
GTCTGAACTACCAAGCACCTGTATTATATGCTTGATATTTGACAAATATCACAAGTCTAG
TTTCTACCGTTTTCTCTGCATTCCTGCTGGAAGCTAATACTAACACATTAATATTCAAGC
AAGTGATTCTGATATAAACTTTTGTAGGGACTGATCACCCAGTGGCTCATCTATATGATA
TTAACACTTTCACATGCTACTTATCGGCAAATTCACATGATTCCAATGCTGCCATTAATC
AGTCACTGATGTTGATGCTAGGTCCGATACTCTTCTACTGGGAGCCTGTATGTGACTGCT
TCCAAGGATGGTTCTCTGCGCATCTGGGATGGGATATCCGCTGAATGTGTCCGGCCCATA
ATTGGAGCACATGCATCTGCAGAGGTTACTAGTGCAATTTTCACAAAAGATGAGAGGTAT
GTCCTATCATGTGGGAAGGATTCTTGTATAAAATTATGGGAAGTTGGCTCTGGACGACTT
GTCAAGCAATATGTAGGCGCTGTTCACAGACAATTTCGATGTCAGGCTGTCTTCAACCAA
ACGGAGGAATTTGTAGTATCAACCGATGAACAAAACAGTGAGGTTGTCGTCTGGGATGCA
CTTACCGCTGAAAATGTAGCAAGGTTGCCCTCTGGCCACACCGGTGCCCCGAGGTGGCTT
GGCCACTCCCCTGCAGAACCAGCCTTTGTTACATGCGGTAACGATAGATCCGTCAGATTC
TGGAAACAAACCGTGTAGAAAATGTAGATCCACCAACGAATCAACCCAGAAGTTGGTGGT
AGAATTAACTAATACATTGAGATTAAAAAACCTTGTTCATGTGCTGTTCCTTAATTATTT
GATTAGTTGTACACTTGTACATGCTACTGAAGTTGTACACTGATGATACTGTACCCAACT
TGGTAGGAAAATTTTGGCTCTTGTTGGCAT

CDS

774 bp

>Os03t0754900-01 Similar to Cleavage stimulation factor, 50 kDa subunit.
ATGGACGCGGCGGTGCAGGAGGCGAAGCTGCTGCGCCAGGTGAACGCCCTCATCGTGGCG
CACCTCCGCGACCACAACCTCACGCAGGCTGCCGCCGCCGTCGCCGCCGCCACCATGACG
CCCCTCGCCCCGCCCGAGCCCGACGGCGACGACTCCGTCCCCGCCAACCAGCTCCTCCGC
CTCGTCGCCAAGGGCCTCGCGGTGGAGCGGGAGGAGACGGGGAGGGGAGGAGGGGCGTTC
GACTCTGCCGCCGCCGCCGCTGGATACGGTGGATTGTTGCCGCCGCTCGGCACCAATGCC
GTGGATTTCAGCACGCAGGATGTTAAGGGCTCATCCAAGAGCTTCCCCAAGCACGAGGCC
AGGCACGTATCTGATCACAAGAATGTTGTCCGATGTGCAAAATTTAGTCCTGATGGGAAA
TATTTTGCATCCGGGAGTGGTGACACATCAATTAAGTTCTTCGAGGTTGCTAAAATAAAG
CAGATGATGCTAGGGGATTCCAAAGATGGCCCTGTCCGTCCTGTGATCCGTACTTTTTAC
GATCACACGCAGCCCATCAATGATCTTGATTTTCATCCTGAGAGCCCCATACTGATATCT
GCAGCAAAAGACAATACAATAAGGTTCTTCGACTTCTCAAAAACTGTTGCAAGGAAAGCA
TTCAGAGTTATTCAGGACACTCACAATGTTAGATCCGTATGTTTTCATCCTTGTGGGGAT
TACCTTTTAGCAGGTAGTACTATTATCCTTTCACCATATGGATTTTACCTGTAA

Protein

258 aa

>Os03t0754900-01 Similar to Cleavage stimulation factor, 50 kDa subunit.
MDAAVQEAKLLRQVNALIVAHLRDHNLTQAAAAVAAATMTPLAPPEPDGDDSVPANQLLR
LVAKGLAVEREETGRGGGAFDSAAAAAGYGGLLPPLGTNAVDFSTQDVKGSSKSFPKHEA
RHVSDHKNVVRCAKFSPDGKYFASGSGDTSIKFFEVAKIKQMMLGDSKDGPVRPVIRTFY
DHTQPINDLDFHPESPILISAAKDNTIRFFDFSKTVARKAFRVIQDTHNVRSVCFHPCGD
YLLAGSTIILSPYGFYL*

5'UTR

chr03:31134446..31134595 (+ strand) : 150 bp

CDS

chr03:31134596..31134787 (+ strand) : 192 bp

chr03:31134913..31135031 (+ strand) : 119 bp

chr03:31135141..31135210 (+ strand) : 70 bp

chr03:31135477..31135560 (+ strand) : 84 bp

chr03:31135657..31135743 (+ strand) : 87 bp

chr03:31135830..31135900 (+ strand) : 71 bp

chr03:31136047..31136098 (+ strand) : 52 bp

chr03:31136206..31136304 (+ strand) : 99 bp

3'UTR

chr03:31136305..31138502 (+ strand) : 2198 bp

chr03:31138583..31138756 (+ strand) : 174 bp

chr03:31138834..31138942 (+ strand) : 109 bp

chr03:31139160..31139216 (+ strand) : 57 bp

chr03:31139312..31139659 (+ strand) : 348 bp

FASTA

>Os03t0754900-01 class=Sequence position=chr03:31134446..31139659 (+ strand)
GGTCAGTCCA GTAGCGGTTC GTCAGTCCAG ACCAGTTCCT AGCTCCGAAC AGAGTCCTTC TCCGAAGTGC GAACTCGCTG
CAAGCCGAAT CCGCCGCGCC GCCACACGGA GACGAGAGGG AGAGGTCGAG AGGGAGAGGG CGAGGGCGAG ATGGACGCGG
CGGTGCAGGA GGCGAAGCTG CTGCGCCAGG TGAACGCCCT CATCGTGGCG CACCTCCGCG ACCACAACCT CACGCAGGCT
GCCGCCGCCG TCGCCGCCGC CACCATGACG CCCCTCGCCC CGCCCGAGCC CGACGGCGAC GACTCCGTCC CCGCCAACCA
GCTCCTCCGC CTCGTCGCCA AGGTTTGCTA TCACTTTCTC CTCGCCCCCC ATGTCCTCCT CCCCTCGGGT GGACGGGGCT
CGTGCAGTGC AGCGCAGCGG AATCCGGCCT AAACCCTCGC TGTGTCGCTG TTGTTGATGG TTCGCAGGGC CTCGCGGTGG
AGCGGGAGGA GACGGGGAGG GGAGGAGGGG CGTTCGACTC TGCCGCCGCC GCCGCTGGAT ACGGTGGATT GTTGCCGCCG
CTCGGCACCA ATGCCGTGGA TTTCAGGTGT TTTAATTTGC TCGTGGCTCT GGGCATTGAC TTGTTAATTC TGTGTACTTG
TTGCTGCTGA TCATGTATGA ATTTGATGGT GAGTGTTCGC TGGTGGTCTG TGCAGCACGC AGGATGTTAA GGGCTCATCC
AAGAGCTTCC CCAAGCACGA GGCCAGGCAC GTATCTGATC ACAAGGTGCA GATGATTAGA GTTCTCCCTT GCGTGATCTG
CCACTGAATT CATTGTTTAT GCCATTTCCT TCTATTTATC TGAATGAAAT CTAAAACCAA CTGGGCAACT TTTTTTTTAT
TTTTAAAAAG GCAAGATAGA AGAATTTAGG AGCATATATC TGGTACCATT TGCAATTTGC ACTTGCCATG GTATTTTGCT
ACACATGGTC TTGCTGTAGA TCCTAATAGT AATGAATGGT GTCTTCATTT GCTTACTCTT ATGTTGTGTA GAATGTTGTC
CGATGTGCAA AATTTAGTCC TGATGGGAAA TATTTTGCAT CCGGGAGTGG TGACACATCA ATTAAGTTCT TCGAGGTGAG
ATTGAATTGG AACTCAACTA CTCAAGTCTC TATCTGCAGG ATGGGTTTTT TAGATTTTAC CTATTGTTCA TTAGTGTTCT
TTCTCTTGCA GGTTGCTAAA ATAAAGCAGA TGATGCTAGG GGATTCCAAA GATGGCCCTG TCCGTCCTGT GATCCGTACT
TTTTACGATC ACACGCAGGT GAGCATGTCA TTCTCATGCA TGATAGTTGT CTGTACTACC ACTGCGCCCT CTGTTAGCAA
GTATACTTAT TTACTTTACT GCAGCCCATC AATGATCTTG ATTTTCATCC TGAGAGCCCC ATACTGATAT CTGCAGCAAA
AGACAATACA ATAAGGTATG CTTAAATTGG TTCTCTCCCA CCTTTGGTAT TTTTGTTGTG TTCTGAGTTG TTCATCTGGG
ATCAAGAATA TTTAACCAAA TGTTCACAAA TATATTGTAC ATTATTTAAT TATGTATTTC CTTGATATAC CTGCCCAACA
GGTTCTTCGA CTTCTCAAAA ACTGTTGCAA GGAAAGCATT CAGAGTTATT CAGGTGGTAA AATTCTTATT AATATTAAAT
TCAATCTTCC AAGATATTCT GTAAAATGTG TGCTAGCTGC ATCCAGTCAG TGCTCTTATT TTCAATATTT ACTTGAACAG
GACACTCACA ATGTTAGATC CGTATGTTTT CATCCTTGTG GGGATTACCT TTTAGCAGGT AGTACTATTA TCCTTTCACC
ATATGGATTT TACCTGTAAA CTTGCTCTGT TGCTCTGGTT ATGAGGTTGT GGTATTAATT TGGTTAATAC GAACTTTTCT
TAGCCTTTCT TTTTTTGGAC CAAAGATAAA TCAGATGATC GATCCAGCTT TACTGAAAAG CCAACAGAGT CTTACAGCAG
AAGACAAAAG ATAGCAGGTG GATTTTCCAG CTTACAAGCA TGAACACTGA GCCAAAACTA CCCACATCTA GACTGAAGAA
CTACATAAAC ACATCACCAC TCCTTTCAGT TTAGTTGAAA CTCCACCAGC TAGATCAGAC AGCTATCAAA CATCACATCT
GCTGCACAAT CATATGTCTT CAGGCAAAAT GTCCCTAGGC TTCAATTCAT TGAGTTTTGC CATGATACTA CTGCACCACT
TGTCCACCCG CTCGTGATCA TTGTCCTTTT GAAGCCTTTT CCAACACTAA AAAAGAAAAT AAGATAAACT TATAACCCCA
CATGCAGTGG AGATTTAACT CGTATCCCTT CAAAAACATA GTTGTTTCTG GTCATCCACA AAGACCAACA AACCCCTTCA
AGCAAGACAA TTCTATTTAT CTGTTTAGCA CTACATCTGT TTATGTTAAG GATATCCTCT ATGGTGCGAA GCAAGACATT
TAGCTTACAT ACATCCCTCA CAGCATTCCA AACATAAGTT CTAAAGGACA ATCAAACAGA ATGTGATTAG TAGTTTCTCT
TTTCTTACAC AGTTTGCAAA AGTTTTAGTC AATTTCTCTG ATACCAGATG TTATGTGGTA GGATGAATTG GGGTGCTCGA
CGGGAAGGCG AGGCTGCTGC AGCCTTGCCG CCCCGGagcc taggtgaggc cgaacagaga agagtggaga ctagagatag
gtttaacttc tttcttgatt aattccaaat gactacggtg cctctcctta tatagagcca gctccTAACA AACATCCTAA
CAACCTTATC TAATAGAGCC TAACAACCTT ATCTTATAAT GAGAGGGGCT GAGTTCTGCC CATAACATGT GCTCATTTTC
GTCCTTCTGC CATGTGGTGT CCCATGTGGA CTTGTAGGGT CAGCACCTTC TTTCCAATTT AGACTATGCA AGTGACTGAA
ATGCGTGCTT TGCATCACCC GAAAAAACAA ATAATGAACT GCATAGGGTC ATCTTACATC GATAGTAATA AAAATTAGGG
CAATGCAGTT ACTTTATATA GTTTGTTGCA TTTGAGGGCC CTGGATATTG TCTACCCGAA CCCTGGATAT TACCTGCCTG
AGACCATCTG TGATGTCATA AGAGGCATTA CCACTAAAGC CTTTCTTTTG TCAAATTTTA TTTTGTGCTG ATGAACCCAT
AGTACCTACA TTTGAAGTTG GTTTCATATC ATACCTTTTT ATTGTATTTG ATGTGATTGT GAAGTATATA ACTGGTCAAT
GTGCTTTTTG GTATTATCTG GCAAACTCTT TTAATTTATT GTTGAGTTTT AGCTTGCGTA CTCATTAGTA CTAAGCATGT
CTAGATTGCT AAAAACTTCT TATGCAGTGG TTTCTTGTTT TCTAATGAAA ATGAGGAACC AGGGTCTAGG TCCTTCATTC
TAAAAACTCT TAATTTATTT GACTAAAACT TTTTGGAGTT CTAGACTGAG GATTTCGATT TTGTTGTGGA ATCAGGCATT
CTTTGCTTCT TTCATTTGAT GTAATCCACC CCCCCCCCCA AGTGAAGACG CTCATATGAA TATTGCTAAC AAACTGATAA
AGATGATAAC ACAAATATGC TATCCATTAG CTGTTTTGAT CATGCAATTG ATTAAGATAA TTTGGACAGT GCCATCCTGA
CCTGACAAGC AGGCTGCTGC CCCTTAGTGC GCACGAGCTG CTCCCGATGC ACCTTCTGTG CACAGACTTA TGATTCCACC
TGATTCCTTG CAAAACAGAG AGCTCAGCAC GTGCTATTGG TGGCCCAGTC AGCCAGTCTG AACTACCAAG CACCTGTATT
ATATGCTTGA TATTTGACAA ATATCACAAG TCTAGTTTCT ACCGTTTTCT CTGCATTCCT GCTGGAAGCT AATACTAACA
CATTAATATT CAAGCAAGTG ATTCTGATAT AAACTTTTGT AGGGACTGAT CACCCAGTGG CTCATCTATA TGATATTAAC
ACTTTCACAT GCTACTTATC GGCAAATTCA CATGATTCCA ATGCTGCCAT TAATCAGGTA TTCATTTTGT GTGAAAGGAC
TTATCCTGGA CTTTTTGTTA ACTCTAGAAA GATGTATATT TACTGTCCTA GCCTTAGTCA CTGATGTTGA TGCTAGGTCC
GATACTCTTC TACTGGGAGC CTGTATGTGA CTGCTTCCAA GGATGGTTCT CTGCGCATCT GGGATGGGAT ATCCGCTGAA
TGTGTCCGGC CCATAATTGG AGCACATGCA TCTGCAGAGG TTACTAGTGC AATTTTCACA AAAGATGAGA GGTTAGCACG
CTGCCTTGTT GTATAAATGA AACCATGTAG CATTGCTATC TGTTATGGTG GCCTCAATGT TCTTTCAGGT ATGTCCTATC
ATGTGGGAAG GATTCTTGTA TAAAATTATG GGAAGTTGGC TCTGGACGAC TTGTCAAGCA ATATGTAGGC GCTGTTCACA
GACAATTTCG ATGTCAGGTC AGCAATGTGC TTACCCTACT ATATTCTCTG ATTTACACCA TTATATATGT TCTGTTGTCA
GCTAAGAACT CCATCTTGGT TGGAACTTTA AAATGTGAGA AAAAGAGTTT GTAATGGTAC CGATTATTTA TTTAATAGTA
TTATTTTTGT GGGGAGGACG GGAGGTAATT GCACCATTAA CTTTGCTATG GTAATAATTG CCTTTTCATT TCAGGCTGTC
TTCAACCAAA CGGAGGAATT TGTAGTATCA ACCGATGAAC AAAACAGTGA GGTAGATTTC AAATTCAGAC CAGTATTTGT
AACTTTCTTT CAGCATTGCC AACAGAAGCC TGAGTGTGCA TATCTGTAAT TCTACTTCAC CTCCAGGTTG TCGTCTGGGA
TGCACTTACC GCTGAAAATG TAGCAAGGTT GCCCTCTGGC CACACCGGTG CCCCGAGGTG GCTTGGCCAC TCCCCTGCAG
AACCAGCCTT TGTTACATGC GGTAACGATA GATCCGTCAG ATTCTGGAAA CAAACCGTGT AGAAAATGTA GATCCACCAA
CGAATCAACC CAGAAGTTGG TGGTAGAATT AACTAATACA TTGAGATTAA AAAACCTTGT TCATGTGCTG TTCCTTAATT
ATTTGATTAG TTGTACACTT GTACATGCTA CTGAAGTTGT ACACTGATGA TACTGTACCC AACTTGGTAG GAAAATTTTG
GCTCTTGTTG GCAT