Os03t0754900-02

Locus

Os03g0754900

Description

Similar to Cleavage stimulation factor, 50 kDa subunit.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-93

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK106405 (DDBJ, Best hit)

Protein Evidence

B4FBI9 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, conserved site (IPR019775)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

Full-length cDNA

002-102-H01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0754900-02)

Others

Oryzabase (10774)

Transcript

1649 bp

>Os03t0754900-02 Similar to Cleavage stimulation factor, 50 kDa subunit.
AGTCCAGACCAGTTCCTAGCTCCGAACAGAGTCCTTCTCCGAAGTGCGAACTCGCTGCAA
GCCGAATCCGCCGCGCCGCCACACGGAGACGAGAGGGAGAGGTCGAGAGGGAGAGGGCGA
GGGCGAGATGGACGCGGCGGTGCAGGAGGCGAAGCTGCTGCGCCAGGTGAACGCCCTCAT
CGTGGCGCACCTCCGCGACCACAACCTCACGCAGGCTGCCGCCGCCGTCGCCGCCGCCAC
CATGACGCCCCTCGCCCCGCCCGAGCCCGACGGCGACGACTCCGTCCCCGCCAACCAGCT
CCTCCGCCTCGTCGCCAAGGGCCTCGCGGTGGAGCGGGAGGAGACGGGGAGGGGAGGAGG
GGCGTTCGACTCTGCCGCCGCCGCCGCTGGATACGGTGGATTGTTGCCGCCGCTCGGCAC
CAATGCCGTGGATTTCAGCACGCAGGATGTTAAGGGCTCATCCAAGAGCTTCCCCAAGCA
CGAGGCCAGGCACGTATCTGATCACAAGAATGTTGTCCGATGTGCAAAATTTAGTCCTGA
TGGGAAATATTTTGCATCCGGGAGTGGTGACACATCAATTAAGTTCTTCGAGGTTGCTAA
AATAAAGCAGATGATGCTAGGGGATTCCAAAGATGGCCCTGTCCGTCCTGTGATCCGTAC
TTTTTACGATCACACGCAGCCCATCAATGATCTTGATTTTCATCCTGAGAGCCCCATACT
GATATCTGCAGCAAAAGACAATACAATAAGGTTCTTCGACTTCTCAAAAACTGTTGCAAG
GAAAGCATTCAGAGTTATTCAGGACACTCACAATGTTAGATCCGTATGTTTTCATCCTTG
TGGGGATTACCTTTTAGCAGGGACTGATCACCCAGTGGCTCATCTATATGATATTAACAC
TTTCACATGCTACTTATCGGCAAATTCACATGATTCCAATGCTGCCATTAATCAGGTCCG
ATACTCTTCTACTGGGAGCCTGTATGTGACTGCTTCCAAGGATGGTTCTCTGCGCATCTG
GGATGGGATATCCGCTGAATGTGTCCGGCCCATAATTGGAGCACATGCATCTGCAGAGGT
TACTAGTGCAATTTTCACAAAAGATGAGAGGTATGTCCTATCATGTGGGAAGGATTCTTG
TATAAAATTATGGGAAGTTGGCTCTGGACGACTTGTCAAGCAATATGTAGGCGCTGTTCA
CAGACAATTTCGATGTCAGGCTGTCTTCAACCAAACGGAGGAATTTGTAGTATCAACCGA
TGAACAAAACAGTGAGGTTGTCGTCTGGGATGCACTTACCGCTGAAAATGTAGCAAGGTT
GCCCTCTGGCCACACCGGTGCCCCGAGGTGGCTTGGCCACTCCCCTGCAGAACCAGCCTT
TGTTACATGCGGTAACGATAGATCCGTCAGATTCTGGAAACAAACCGTGTAGAAAATGTA
GATCCACCAACGAATCAACCCAGAAGTTGGTGGTAGAATTAACTAATACATTGAGATTAA
AAAACCTTGTTCATGTGCTGTTCCTTAATTATTTGATTAGTTGTACACTTGTACATGCTA
CTGAAGTTGTACACTGATGATACTGTACCCAACTTGGTAGGAAAATTTTGGCTCTTGTTG
GCATTCATGTAAGCAGAATTCAGAACTTG

CDS

1305 bp

>Os03t0754900-02 Similar to Cleavage stimulation factor, 50 kDa subunit.
ATGGACGCGGCGGTGCAGGAGGCGAAGCTGCTGCGCCAGGTGAACGCCCTCATCGTGGCG
CACCTCCGCGACCACAACCTCACGCAGGCTGCCGCCGCCGTCGCCGCCGCCACCATGACG
CCCCTCGCCCCGCCCGAGCCCGACGGCGACGACTCCGTCCCCGCCAACCAGCTCCTCCGC
CTCGTCGCCAAGGGCCTCGCGGTGGAGCGGGAGGAGACGGGGAGGGGAGGAGGGGCGTTC
GACTCTGCCGCCGCCGCCGCTGGATACGGTGGATTGTTGCCGCCGCTCGGCACCAATGCC
GTGGATTTCAGCACGCAGGATGTTAAGGGCTCATCCAAGAGCTTCCCCAAGCACGAGGCC
AGGCACGTATCTGATCACAAGAATGTTGTCCGATGTGCAAAATTTAGTCCTGATGGGAAA
TATTTTGCATCCGGGAGTGGTGACACATCAATTAAGTTCTTCGAGGTTGCTAAAATAAAG
CAGATGATGCTAGGGGATTCCAAAGATGGCCCTGTCCGTCCTGTGATCCGTACTTTTTAC
GATCACACGCAGCCCATCAATGATCTTGATTTTCATCCTGAGAGCCCCATACTGATATCT
GCAGCAAAAGACAATACAATAAGGTTCTTCGACTTCTCAAAAACTGTTGCAAGGAAAGCA
TTCAGAGTTATTCAGGACACTCACAATGTTAGATCCGTATGTTTTCATCCTTGTGGGGAT
TACCTTTTAGCAGGGACTGATCACCCAGTGGCTCATCTATATGATATTAACACTTTCACA
TGCTACTTATCGGCAAATTCACATGATTCCAATGCTGCCATTAATCAGGTCCGATACTCT
TCTACTGGGAGCCTGTATGTGACTGCTTCCAAGGATGGTTCTCTGCGCATCTGGGATGGG
ATATCCGCTGAATGTGTCCGGCCCATAATTGGAGCACATGCATCTGCAGAGGTTACTAGT
GCAATTTTCACAAAAGATGAGAGGTATGTCCTATCATGTGGGAAGGATTCTTGTATAAAA
TTATGGGAAGTTGGCTCTGGACGACTTGTCAAGCAATATGTAGGCGCTGTTCACAGACAA
TTTCGATGTCAGGCTGTCTTCAACCAAACGGAGGAATTTGTAGTATCAACCGATGAACAA
AACAGTGAGGTTGTCGTCTGGGATGCACTTACCGCTGAAAATGTAGCAAGGTTGCCCTCT
GGCCACACCGGTGCCCCGAGGTGGCTTGGCCACTCCCCTGCAGAACCAGCCTTTGTTACA
TGCGGTAACGATAGATCCGTCAGATTCTGGAAACAAACCGTGTAG

Protein

435 aa

>Os03t0754900-02 Similar to Cleavage stimulation factor, 50 kDa subunit.
MDAAVQEAKLLRQVNALIVAHLRDHNLTQAAAAVAAATMTPLAPPEPDGDDSVPANQLLR
LVAKGLAVEREETGRGGGAFDSAAAAAGYGGLLPPLGTNAVDFSTQDVKGSSKSFPKHEA
RHVSDHKNVVRCAKFSPDGKYFASGSGDTSIKFFEVAKIKQMMLGDSKDGPVRPVIRTFY
DHTQPINDLDFHPESPILISAAKDNTIRFFDFSKTVARKAFRVIQDTHNVRSVCFHPCGD
YLLAGTDHPVAHLYDINTFTCYLSANSHDSNAAINQVRYSSTGSLYVTASKDGSLRIWDG
ISAECVRPIIGAHASAEVTSAIFTKDERYVLSCGKDSCIKLWEVGSGRLVKQYVGAVHRQ
FRCQAVFNQTEEFVVSTDEQNSEVVVWDALTAENVARLPSGHTGAPRWLGHSPAEPAFVT
CGNDRSVRFWKQTV*

5'UTR

chr03:31134469..31134595 (+ strand) : 127 bp

CDS

chr03:31134596..31134787 (+ strand) : 192 bp

chr03:31134913..31135031 (+ strand) : 119 bp

chr03:31135141..31135210 (+ strand) : 70 bp

chr03:31135477..31135560 (+ strand) : 84 bp

chr03:31135657..31135743 (+ strand) : 87 bp

chr03:31135830..31135900 (+ strand) : 71 bp

chr03:31136047..31136098 (+ strand) : 52 bp

chr03:31136206..31136263 (+ strand) : 58 bp

chr03:31138408..31138502 (+ strand) : 95 bp

chr03:31138602..31138756 (+ strand) : 155 bp

chr03:31138834..31138942 (+ strand) : 109 bp

chr03:31139160..31139216 (+ strand) : 57 bp

chr03:31139312..31139467 (+ strand) : 156 bp

3'UTR

chr03:31139468..31139684 (+ strand) : 217 bp

FASTA

>Os03t0754900-02 class=Sequence position=chr03:31134469..31139684 (+ strand)
AGTCCAGACC AGTTCCTAGC TCCGAACAGA GTCCTTCTCC GAAGTGCGAA CTCGCTGCAA GCCGAATCCG CCGCGCCGCC
ACACGGAGAC GAGAGGGAGA GGTCGAGAGG GAGAGGGCGA GGGCGAGATG GACGCGGCGG TGCAGGAGGC GAAGCTGCTG
CGCCAGGTGA ACGCCCTCAT CGTGGCGCAC CTCCGCGACC ACAACCTCAC GCAGGCTGCC GCCGCCGTCG CCGCCGCCAC
CATGACGCCC CTCGCCCCGC CCGAGCCCGA CGGCGACGAC TCCGTCCCCG CCAACCAGCT CCTCCGCCTC GTCGCCAAGG
TTTGCTATCA CTTTCTCCTC GCCCCCCATG TCCTCCTCCC CTCGGGTGGA CGGGGCTCGT GCAGTGCAGC GCAGCGGAAT
CCGGCCTAAA CCCTCGCTGT GTCGCTGTTG TTGATGGTTC GCAGGGCCTC GCGGTGGAGC GGGAGGAGAC GGGGAGGGGA
GGAGGGGCGT TCGACTCTGC CGCCGCCGCC GCTGGATACG GTGGATTGTT GCCGCCGCTC GGCACCAATG CCGTGGATTT
CAGGTGTTTT AATTTGCTCG TGGCTCTGGG CATTGACTTG TTAATTCTGT GTACTTGTTG CTGCTGATCA TGTATGAATT
TGATGGTGAG TGTTCGCTGG TGGTCTGTGC AGCACGCAGG ATGTTAAGGG CTCATCCAAG AGCTTCCCCA AGCACGAGGC
CAGGCACGTA TCTGATCACA AGGTGCAGAT GATTAGAGTT CTCCCTTGCG TGATCTGCCA CTGAATTCAT TGTTTATGCC
ATTTCCTTCT ATTTATCTGA ATGAAATCTA AAACCAACTG GGCAACTTTT TTTTTATTTT TAAAAAGGCA AGATAGAAGA
ATTTAGGAGC ATATATCTGG TACCATTTGC AATTTGCACT TGCCATGGTA TTTTGCTACA CATGGTCTTG CTGTAGATCC
TAATAGTAAT GAATGGTGTC TTCATTTGCT TACTCTTATG TTGTGTAGAA TGTTGTCCGA TGTGCAAAAT TTAGTCCTGA
TGGGAAATAT TTTGCATCCG GGAGTGGTGA CACATCAATT AAGTTCTTCG AGGTGAGATT GAATTGGAAC TCAACTACTC
AAGTCTCTAT CTGCAGGATG GGTTTTTTAG ATTTTACCTA TTGTTCATTA GTGTTCTTTC TCTTGCAGGT TGCTAAAATA
AAGCAGATGA TGCTAGGGGA TTCCAAAGAT GGCCCTGTCC GTCCTGTGAT CCGTACTTTT TACGATCACA CGCAGGTGAG
CATGTCATTC TCATGCATGA TAGTTGTCTG TACTACCACT GCGCCCTCTG TTAGCAAGTA TACTTATTTA CTTTACTGCA
GCCCATCAAT GATCTTGATT TTCATCCTGA GAGCCCCATA CTGATATCTG CAGCAAAAGA CAATACAATA AGGTATGCTT
AAATTGGTTC TCTCCCACCT TTGGTATTTT TGTTGTGTTC TGAGTTGTTC ATCTGGGATC AAGAATATTT AACCAAATGT
TCACAAATAT ATTGTACATT ATTTAATTAT GTATTTCCTT GATATACCTG CCCAACAGGT TCTTCGACTT CTCAAAAACT
GTTGCAAGGA AAGCATTCAG AGTTATTCAG GTGGTAAAAT TCTTATTAAT ATTAAATTCA ATCTTCCAAG ATATTCTGTA
AAATGTGTGC TAGCTGCATC CAGTCAGTGC TCTTATTTTC AATATTTACT TGAACAGGAC ACTCACAATG TTAGATCCGT
ATGTTTTCAT CCTTGTGGGG ATTACCTTTT AGCAGGTAGT ACTATTATCC TTTCACCATA TGGATTTTAC CTGTAAACTT
GCTCTGTTGC TCTGGTTATG AGGTTGTGGT ATTAATTTGG TTAATACGAA CTTTTCTTAG CCTTTCTTTT TTTGGACCAA
AGATAAATCA GATGATCGAT CCAGCTTTAC TGAAAAGCCA ACAGAGTCTT ACAGCAGAAG ACAAAAGATA GCAGGTGGAT
TTTCCAGCTT ACAAGCATGA ACACTGAGCC AAAACTACCC ACATCTAGAC TGAAGAACTA CATAAACACA TCACCACTCC
TTTCAGTTTA GTTGAAACTC CACCAGCTAG ATCAGACAGC TATCAAACAT CACATCTGCT GCACAATCAT ATGTCTTCAG
GCAAAATGTC CCTAGGCTTC AATTCATTGA GTTTTGCCAT GATACTACTG CACCACTTGT CCACCCGCTC GTGATCATTG
TCCTTTTGAA GCCTTTTCCA ACACTAAAAA AGAAAATAAG ATAAACTTAT AACCCCACAT GCAGTGGAGA TTTAACTCGT
ATCCCTTCAA AAACATAGTT GTTTCTGGTC ATCCACAAAG ACCAACAAAC CCCTTCAAGC AAGACAATTC TATTTATCTG
TTTAGCACTA CATCTGTTTA TGTTAAGGAT ATCCTCTATG GTGCGAAGCA AGACATTTAG CTTACATACA TCCCTCACAG
CATTCCAAAC ATAAGTTCTA AAGGACAATC AAACAGAATG TGATTAGTAG TTTCTCTTTT CTTACACAGT TTGCAAAAGT
TTTAGTCAAT TTCTCTGATA CCAGATGTTA TGTGGTAGGA TGAATTGGGG TGCTCGACGG GAAGGCGAGG CTGCTGCAGC
CTTGCCGCCC CGGagcctag gtgaggccga acagagaaga gtggagacta gagataggtt taacttcttt cttgattaat
tccaaatgac tacggtgcct ctccttatat agagccagct ccTAACAAAC ATCCTAACAA CCTTATCTAA TAGAGCCTAA
CAACCTTATC TTATAATGAG AGGGGCTGAG TTCTGCCCAT AACATGTGCT CATTTTCGTC CTTCTGCCAT GTGGTGTCCC
ATGTGGACTT GTAGGGTCAG CACCTTCTTT CCAATTTAGA CTATGCAAGT GACTGAAATG CGTGCTTTGC ATCACCCGAA
AAAACAAATA ATGAACTGCA TAGGGTCATC TTACATCGAT AGTAATAAAA ATTAGGGCAA TGCAGTTACT TTATATAGTT
TGTTGCATTT GAGGGCCCTG GATATTGTCT ACCCGAACCC TGGATATTAC CTGCCTGAGA CCATCTGTGA TGTCATAAGA
GGCATTACCA CTAAAGCCTT TCTTTTGTCA AATTTTATTT TGTGCTGATG AACCCATAGT ACCTACATTT GAAGTTGGTT
TCATATCATA CCTTTTTATT GTATTTGATG TGATTGTGAA GTATATAACT GGTCAATGTG CTTTTTGGTA TTATCTGGCA
AACTCTTTTA ATTTATTGTT GAGTTTTAGC TTGCGTACTC ATTAGTACTA AGCATGTCTA GATTGCTAAA AACTTCTTAT
GCAGTGGTTT CTTGTTTTCT AATGAAAATG AGGAACCAGG GTCTAGGTCC TTCATTCTAA AAACTCTTAA TTTATTTGAC
TAAAACTTTT TGGAGTTCTA GACTGAGGAT TTCGATTTTG TTGTGGAATC AGGCATTCTT TGCTTCTTTC ATTTGATGTA
ATCCACCCCC CCCCCCAAGT GAAGACGCTC ATATGAATAT TGCTAACAAA CTGATAAAGA TGATAACACA AATATGCTAT
CCATTAGCTG TTTTGATCAT GCAATTGATT AAGATAATTT GGACAGTGCC ATCCTGACCT GACAAGCAGG CTGCTGCCCC
TTAGTGCGCA CGAGCTGCTC CCGATGCACC TTCTGTGCAC AGACTTATGA TTCCACCTGA TTCCTTGCAA AACAGAGAGC
TCAGCACGTG CTATTGGTGG CCCAGTCAGC CAGTCTGAAC TACCAAGCAC CTGTATTATA TGCTTGATAT TTGACAAATA
TCACAAGTCT AGTTTCTACC GTTTTCTCTG CATTCCTGCT GGAAGCTAAT ACTAACACAT TAATATTCAA GCAAGTGATT
CTGATATAAA CTTTTGTAGG GACTGATCAC CCAGTGGCTC ATCTATATGA TATTAACACT TTCACATGCT ACTTATCGGC
AAATTCACAT GATTCCAATG CTGCCATTAA TCAGGTATTC ATTTTGTGTG AAAGGACTTA TCCTGGACTT TTTGTTAACT
CTAGAAAGAT GTATATTTAC TGTCCTAGCC TTAGTCACTG ATGTTGATGC TAGGTCCGAT ACTCTTCTAC TGGGAGCCTG
TATGTGACTG CTTCCAAGGA TGGTTCTCTG CGCATCTGGG ATGGGATATC CGCTGAATGT GTCCGGCCCA TAATTGGAGC
ACATGCATCT GCAGAGGTTA CTAGTGCAAT TTTCACAAAA GATGAGAGGT TAGCACGCTG CCTTGTTGTA TAAATGAAAC
CATGTAGCAT TGCTATCTGT TATGGTGGCC TCAATGTTCT TTCAGGTATG TCCTATCATG TGGGAAGGAT TCTTGTATAA
AATTATGGGA AGTTGGCTCT GGACGACTTG TCAAGCAATA TGTAGGCGCT GTTCACAGAC AATTTCGATG TCAGGTCAGC
AATGTGCTTA CCCTACTATA TTCTCTGATT TACACCATTA TATATGTTCT GTTGTCAGCT AAGAACTCCA TCTTGGTTGG
AACTTTAAAA TGTGAGAAAA AGAGTTTGTA ATGGTACCGA TTATTTATTT AATAGTATTA TTTTTGTGGG GAGGACGGGA
GGTAATTGCA CCATTAACTT TGCTATGGTA ATAATTGCCT TTTCATTTCA GGCTGTCTTC AACCAAACGG AGGAATTTGT
AGTATCAACC GATGAACAAA ACAGTGAGGT AGATTTCAAA TTCAGACCAG TATTTGTAAC TTTCTTTCAG CATTGCCAAC
AGAAGCCTGA GTGTGCATAT CTGTAATTCT ACTTCACCTC CAGGTTGTCG TCTGGGATGC ACTTACCGCT GAAAATGTAG
CAAGGTTGCC CTCTGGCCAC ACCGGTGCCC CGAGGTGGCT TGGCCACTCC CCTGCAGAAC CAGCCTTTGT TACATGCGGT
AACGATAGAT CCGTCAGATT CTGGAAACAA ACCGTGTAGA AAATGTAGAT CCACCAACGA ATCAACCCAG AAGTTGGTGG
TAGAATTAAC TAATACATTG AGATTAAAAA ACCTTGTTCA TGTGCTGTTC CTTAATTATT TGATTAGTTG TACACTTGTA
CATGCTACTG AAGTTGTACA CTGATGATAC TGTACCCAAC TTGGTAGGAA AATTTTGGCT CTTGTTGGCA TTCATGTAAG
CAGAATTCAG AACTTG