Os03t0760800-01

Locus

Os03g0760800

Description

A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Control of seedling growth and α-amylase expression, Cell proliferation in meristems and panicles development

RAP-DB Gene Symbol Synonym(s)

GASR1, OsGASR1

RAP-DB Gene Name Synonym(s)

GA Stimulated Rice 1, GA-stimulated transcript-related gene 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsGASR1, GASR1

Oryzabase Gene Name Synonym(s)

GAST (GA-stimulated transcript) homolog 1, GAST homolog 1, GA-stimulated transcript homolog 1, GA-stimulated transcript-related gene 1

Transcript Evidence

AK121316

AB192574

Protein Evidence

Q94HA1

Literature

PMID: 28482332

PMID: 16905871

Note

Manual Curation

June 14, 2017

Functional domain (InterPro)

Gibberellin regulated protein (IPR003854)

Experimentally confirmed subcellular location

apoplast (GO:0048046)

cell wall (GO:0005618)

Full-length cDNA

J023113B01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0760800-01)

RiceXPro (AK121316)

Others

Oryzabase (14271)

KEGG (Os03t0760800-01)

Transcript

698 bp

>Os03t0760800-01 A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Control of seedling growth and α-amylase expression, Cell proliferation in meristems and panicles development
ACTCTCCACAACACCCCAACTCTGAAGCTGCTTGCTTGGAGTCTAGGACCAGCATTCACA
AGCACAATGAAGCTCAACACCACCACCACCCTGGCTCTCCTCCTGCTCCTGCTCTTGGCC
TCCTCTTCCCTCCAAGTTTCCATGGCTGGATCAGATTTCTGCGACGGCAAGTGCAAGGTG
AGGTGCTCGAAGGCGAGCAGGCACGACGACTGCCTCAAGTACTGCGGCGTGTGCTGCGCC
TCCTGCAACTGCGTGCCGTCGGGGACGGCCGGCAACAAGGACGAGTGCCCCTGCTACCGC
GACATGACCACCGGCCATGGCGCTCGCAAGAGGCCCAAGTGCCCATGATCATTTTTGCAT
TATGCATGCTACATGATGCTTAGCCATCATCCGTAGTTGCTTTGCATGCATGATGCATGC
TCATGATCGAGATGGAGTAGTAGATATATGCATATGCTTGCCATGATCGATCGTATGGAC
CATGCAAAGTATGCTTGTTTGTGTGAGGATCGACTCGATCTTGAGTCTTTCCATGTTCTT
GGTTTTCTTTTTTTACTGCTAGTTAATTACTATGGAGTACATGTGAATATGACATCGGAT
ATGTAATGTATACATGCATGCCTGGTGATAATAATGGTGTGTGTGCTGTAATAAAGTGTT
GGCTTAATTGGTGTAGTACATGTTCAGTTTAGTGTGCC

CDS

282 bp

>Os03t0760800-01 A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Control of seedling growth and α-amylase expression, Cell proliferation in meristems and panicles development
ATGAAGCTCAACACCACCACCACCCTGGCTCTCCTCCTGCTCCTGCTCTTGGCCTCCTCT
TCCCTCCAAGTTTCCATGGCTGGATCAGATTTCTGCGACGGCAAGTGCAAGGTGAGGTGC
TCGAAGGCGAGCAGGCACGACGACTGCCTCAAGTACTGCGGCGTGTGCTGCGCCTCCTGC
AACTGCGTGCCGTCGGGGACGGCCGGCAACAAGGACGAGTGCCCCTGCTACCGCGACATG
ACCACCGGCCATGGCGCTCGCAAGAGGCCCAAGTGCCCATGA

Protein

94 aa

>Os03t0760800-01 A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Control of seedling growth and α-amylase expression, Cell proliferation in meristems and panicles development
MKLNTTTTLALLLLLLLASSSLQVSMAGSDFCDGKCKVRCSKASRHDDCLKYCGVCCASC
NCVPSGTAGNKDECPCYRDMTTGHGARKRPKCP*

5'UTR

chr03:31465558..31465623 (- strand) : 66 bp

CDS

chr03:31465470..31465557 (- strand) : 88 bp

chr03:31465171..31465364 (- strand) : 194 bp

3'UTR

chr03:31464821..31465170 (- strand) : 350 bp

FASTA

>Os03t0760800-01 class=Sequence position=chr03:31464821..31465623 (- strand)
ACTCTCCACA ACACCCCAAC TCTGAAGCTG CTTGCTTGGA GTCTAGGACC AGCATTCACA AGCACAATGA AGCTCAACAC
CACCACCACC CTGGCTCTCC TCCTGCTCCT GCTCTTGGCC TCCTCTTCCC TCCAAGTTTC CATGGCTGGA TCAGGTCAGT
TTTCACAGGC ATTTTTTTTA GCAGAATAAT CTGCACAAGT ACACTGTTTT TCTTTCTTGG TGTTAACATG GTGAGCTGAA
ACAATGAATG TTTTGGTAGA TTTCTGCGAC GGCAAGTGCA AGGTGAGGTG CTCGAAGGCG AGCAGGCACG ACGACTGCCT
CAAGTACTGC GGCGTGTGCT GCGCCTCCTG CAACTGCGTG CCGTCGGGGA CGGCCGGCAA CAAGGACGAG TGCCCCTGCT
ACCGCGACAT GACCACCGGC CATGGCGCTC GCAAGAGGCC CAAGTGCCCA TGATCATTTT TGCATTATGC ATGCTACATG
ATGCTTAGCC ATCATCCGTA GTTGCTTTGC ATGCATGATG CATGCTCATG ATCGAGATGG AGTAGTAGAT ATATGCATAT
GCTTGCCATG ATCGATCGTA TGGACCATGC AAAGTATGCT TGTTTGTGTG AGGATCGACT CGATCTTGAG TCTTTCCATG
TTCTTGGTTT TCTTTTTTTA CTGCTAGTTA ATTACTATGG AGTACATGTG AATATGACAT CGGATATGTA ATGTATACAT
GCATGCCTGG TGATAATAAT GGTGTGTGTG CTGTAATAAA GTGTTGGCTT AATTGGTGTA GTACATGTTC AGTTTAGTGT
GCC

Locus: Os03g0760800

Loading...

Locus: Os03g0760800

Loading...