Os03t0761700-01

Locus

Os03g0761700

Description

Heat shock protein DnaJ family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjC34

Oryzabase Gene Name Synonym(s)

DnaJ domain protein C34

Transcript Evidence

AK068309 (DDBJ, Best hit)

Protein Evidence

A2XM85 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, N-terminal (IPR001623)

Heat shock protein DnaJ (IPR003095)

Full-length cDNA

J013149B16 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0761700-01)

RiceXPro (AK068309)

Others

Oryzabase (12191)

KEGG (Os03t0761700-01)

Transcript

2222 bp

>Os03t0761700-01 Heat shock protein DnaJ family protein.
ACTCCGGCCCCACGCGACAGAGCAACGGCGGGAGCGAAGTGATGGCGCTTCGGGCGGCGG
AGCTCCGGCGACTCGTCGTCCTCCTCCGCGGCGAGGCGGCCCTTCCGCTCCCCCTCGCGT
GGCGCGGCCGGCCGGTGAGCACCGCCGCTCGCGACGACGAGCTCGCCGGGAAGAGCGCCT
ATGAGGTGCTCGGGGTCGGGGAGACCAGCTCCTCCGCCGAGATCAAGGCCTCCTTCCACC
GCCTCGCCAAGGAGACCCACCCCGACGTCGCCGCCGCCGCCGGGTCCAGCCGCTTCCTTC
AGATCCTCGCTGCCTACGAGATCCTATCGGATTCACAGAGAAGGGCTCACTATGATATCT
ACCTGCGATCGCAGAAGCGAGTTTTGCAGAAGCATCCTAGGCCATCTCATCATGTATATC
CAAATCCAAGTGGTTCAGGCATTGTAGTAACAAGAGAAAGTAATGTTGTTGAGTGGCTAA
AATGGTATAGGCTCACTATTGATGACATAGTTACAAAGAAGAGGGTTGCGACAGGGTCAG
GTTACTTTGATAAGCTTGAAAGTGAACTGTACACAGCAATCCATGCTGCATACTATGGTC
CGGATGTTCGGTCTGTGGATCTCCTTCCTGATTGCTTTGAAGCTGAGGAGAGGTCTGTAT
ATGAGACCCCTGAGCTATTGCACCTTGTATCGGGTCGTGATCTGTTTGGTATTGTTAGTC
TAGCTGATAGAGTTCAACAGCTGCCAGATGCTTTTCAGGAGAAGCAGACGCTACCTGGTT
TTAAAACTTACGGGATTAGTCAGCATGTTTCAACAAACTTGGAGAAAGGCACAGTACACG
CCAGTCCTGTATATATTCACAAGAGAGAGATTGACAAGAATGATGGTCCTCATTCAGATG
CCTACAAGGATATTGAATTGTGGATCTGTGGGAAATTAGTAGCTACTGCAACGAGGAGCC
CTAAGTGCAATTGTATTGATAAATCAGATGTGGAAGATCACATACATGTATTTCTTGTCC
CAAATGAAGTGGCTTCATCTGATTTTACACAAGAGCTTCCTATCCTGGGAACTATTACTG
GCTTGGCCACCACTGGGGAGGAAGGATCTTGCTGTGTCTATGATAGCCGTGGGATAAAGA
CACATCTAATTGTCAAGCACAGAACATTAATGGTCAAACACATGCACTGGTATCAAGTTG
GAGATGAAATTTCTCCATGTGAGTGTCGATGCAGTAGGGCTCGGTTGCCACCTAGTAGAT
ATTGGCTTTTTGAGCCTCGTTGTTATATGCATGACACTGGTGGCTGGTACATTGAGACCT
TTGGAAGGGACAAGAAAGGGAGGAAAATTCTATCACCAAGACAATGGGATGGTTCCAATG
AACACTCTGAAAGGAGGTTGCATCCAGCAATGTATCTGGCAGCTCTAGCTTACAGATCTT
TGGATATTGAGGATGCTCAACGAAAGAAATGGAGCATTACGACCTTCCTGGAACTGCAGT
CATCTCATATCTGTCAATTGTGCAAAAAAATCTTCAATGGGGGAAAGGAAAGTTCATGAG
AACACCATGAGAAATGCACAGCAGTTTCAAGAATTTGATCTTTGACAACTCTGATACTAT
GATGCCATGCCTTGTTCACCCGTTGATCATATCCTTGAGATTTTGGTGTGGCTATGTAGC
ATCATGGCACTGCACTGGAAGATATATAGTGCACCTCTAGAATAAGCAAAATTATCTGAG
GCTGTTCATTGTGCTGATTGTTGGATGTGGCACCCCTGGTCAATAGCTTTTTTGCTGTGC
TGATGTCAGAATTTCCACACCATTTGCTATGAAAGGACAGACATTATGGCTTCAGCCATG
GCCAGTTAACTTGAAGTCTGTCTTATGACCAACGGGTGGGAATATGGGAGAAAGTTAATA
ATTACTTGGCTTCTCGACTGGAGTTTAATCTACTTGGCATATTGATTTTATATTAGGCGA
GCACCCTCTAAATTTGGTGAAGGTGAGAGATGAAGCAGCCACCGAGCTTAGCGTGAACAT
TCTAAGAAAAGGGGAAAGCACTATGAAAAAGCACCAGCAAGCAGCAACAGCTCTGCATGG
AGAGGGATATTGTATTTTCTTAGCCTCTTAGGTGTCGACTGAGTTGCGCATGCTATTGTG
GGCAAGTTGTTTATGTTTGAGACAATGAATTTTGCTTCTATAGTTCCACCTGATGGAAGA
CT

CDS

1518 bp

>Os03t0761700-01 Heat shock protein DnaJ family protein.
ATGGCGCTTCGGGCGGCGGAGCTCCGGCGACTCGTCGTCCTCCTCCGCGGCGAGGCGGCC
CTTCCGCTCCCCCTCGCGTGGCGCGGCCGGCCGGTGAGCACCGCCGCTCGCGACGACGAG
CTCGCCGGGAAGAGCGCCTATGAGGTGCTCGGGGTCGGGGAGACCAGCTCCTCCGCCGAG
ATCAAGGCCTCCTTCCACCGCCTCGCCAAGGAGACCCACCCCGACGTCGCCGCCGCCGCC
GGGTCCAGCCGCTTCCTTCAGATCCTCGCTGCCTACGAGATCCTATCGGATTCACAGAGA
AGGGCTCACTATGATATCTACCTGCGATCGCAGAAGCGAGTTTTGCAGAAGCATCCTAGG
CCATCTCATCATGTATATCCAAATCCAAGTGGTTCAGGCATTGTAGTAACAAGAGAAAGT
AATGTTGTTGAGTGGCTAAAATGGTATAGGCTCACTATTGATGACATAGTTACAAAGAAG
AGGGTTGCGACAGGGTCAGGTTACTTTGATAAGCTTGAAAGTGAACTGTACACAGCAATC
CATGCTGCATACTATGGTCCGGATGTTCGGTCTGTGGATCTCCTTCCTGATTGCTTTGAA
GCTGAGGAGAGGTCTGTATATGAGACCCCTGAGCTATTGCACCTTGTATCGGGTCGTGAT
CTGTTTGGTATTGTTAGTCTAGCTGATAGAGTTCAACAGCTGCCAGATGCTTTTCAGGAG
AAGCAGACGCTACCTGGTTTTAAAACTTACGGGATTAGTCAGCATGTTTCAACAAACTTG
GAGAAAGGCACAGTACACGCCAGTCCTGTATATATTCACAAGAGAGAGATTGACAAGAAT
GATGGTCCTCATTCAGATGCCTACAAGGATATTGAATTGTGGATCTGTGGGAAATTAGTA
GCTACTGCAACGAGGAGCCCTAAGTGCAATTGTATTGATAAATCAGATGTGGAAGATCAC
ATACATGTATTTCTTGTCCCAAATGAAGTGGCTTCATCTGATTTTACACAAGAGCTTCCT
ATCCTGGGAACTATTACTGGCTTGGCCACCACTGGGGAGGAAGGATCTTGCTGTGTCTAT
GATAGCCGTGGGATAAAGACACATCTAATTGTCAAGCACAGAACATTAATGGTCAAACAC
ATGCACTGGTATCAAGTTGGAGATGAAATTTCTCCATGTGAGTGTCGATGCAGTAGGGCT
CGGTTGCCACCTAGTAGATATTGGCTTTTTGAGCCTCGTTGTTATATGCATGACACTGGT
GGCTGGTACATTGAGACCTTTGGAAGGGACAAGAAAGGGAGGAAAATTCTATCACCAAGA
CAATGGGATGGTTCCAATGAACACTCTGAAAGGAGGTTGCATCCAGCAATGTATCTGGCA
GCTCTAGCTTACAGATCTTTGGATATTGAGGATGCTCAACGAAAGAAATGGAGCATTACG
ACCTTCCTGGAACTGCAGTCATCTCATATCTGTCAATTGTGCAAAAAAATCTTCAATGGG
GGAAAGGAAAGTTCATGA

Protein

506 aa

>Os03t0761700-01 Heat shock protein DnaJ family protein.
MALRAAELRRLVVLLRGEAALPLPLAWRGRPVSTAARDDELAGKSAYEVLGVGETSSSAE
IKASFHRLAKETHPDVAAAAGSSRFLQILAAYEILSDSQRRAHYDIYLRSQKRVLQKHPR
PSHHVYPNPSGSGIVVTRESNVVEWLKWYRLTIDDIVTKKRVATGSGYFDKLESELYTAI
HAAYYGPDVRSVDLLPDCFEAEERSVYETPELLHLVSGRDLFGIVSLADRVQQLPDAFQE
KQTLPGFKTYGISQHVSTNLEKGTVHASPVYIHKREIDKNDGPHSDAYKDIELWICGKLV
ATATRSPKCNCIDKSDVEDHIHVFLVPNEVASSDFTQELPILGTITGLATTGEEGSCCVY
DSRGIKTHLIVKHRTLMVKHMHWYQVGDEISPCECRCSRARLPPSRYWLFEPRCYMHDTG
GWYIETFGRDKKGRKILSPRQWDGSNEHSERRLHPAMYLAALAYRSLDIEDAQRKKWSIT
TFLELQSSHICQLCKKIFNGGKESS*

5'UTR

chr03:31495921..31495961 (+ strand) : 41 bp

CDS

chr03:31495962..31496240 (+ strand) : 279 bp

chr03:31496451..31497302 (+ strand) : 852 bp

chr03:31497508..31497593 (+ strand) : 86 bp

chr03:31497943..31498077 (+ strand) : 135 bp

chr03:31498486..31498651 (+ strand) : 166 bp

3'UTR

chr03:31498652..31498940 (+ strand) : 289 bp

chr03:31499567..31499764 (+ strand) : 198 bp

chr03:31499903..31500078 (+ strand) : 176 bp

FASTA

>Os03t0761700-01 class=Sequence position=chr03:31495921..31500078 (+ strand)
ACTCCGGCCC CACGCGACAG AGCAACGGCG GGAGCGAAGT GATGGCGCTT CGGGCGGCGG AGCTCCGGCG ACTCGTCGTC
CTCCTCCGCG GCGAGGCGGC CCTTCCGCTC CCCCTCGCGT GGCGCGGCCG GCCGGTGAGC ACCGCCGCTC GCGACGACGA
GCTCGCCGGG AAGAGCGCCT ATGAGGTGCT CGGGGTCGGG GAGACCAGCT CCTCCGCCGA GATCAAGGCC TCCTTCCACC
GCCTCGCCAA GGAGACCCAC CCCGACGTCG CCGCCGCCGC CGGGTCCAGC CGCTTCCTTC AGATCCTCGC TGCCTACGAG
GTGTTCATTC GATTCACTTG GCTACTTAGA TAAGGGAATG GGGCTACTAA TGGGTAATTG GGGGTATCAT GAGTGCAAAC
TTTCAAACCC TACCATATGA TTATAATTGT TATGATTGTA GTATTGATAA ATTGAGGGGG CAAGACTTTG TACTATGAAG
GAATCAAAAC ATGGAGAAAT TTAATGGTTA ACAATATTGT TATGTTGCAG ATCCTATCGG ATTCACAGAG AAGGGCTCAC
TATGATATCT ACCTGCGATC GCAGAAGCGA GTTTTGCAGA AGCATCCTAG GCCATCTCAT CATGTATATC CAAATCCAAG
TGGTTCAGGC ATTGTAGTAA CAAGAGAAAG TAATGTTGTT GAGTGGCTAA AATGGTATAG GCTCACTATT GATGACATAG
TTACAAAGAA GAGGGTTGCG ACAGGGTCAG GTTACTTTGA TAAGCTTGAA AGTGAACTGT ACACAGCAAT CCATGCTGCA
TACTATGGTC CGGATGTTCG GTCTGTGGAT CTCCTTCCTG ATTGCTTTGA AGCTGAGGAG AGGTCTGTAT ATGAGACCCC
TGAGCTATTG CACCTTGTAT CGGGTCGTGA TCTGTTTGGT ATTGTTAGTC TAGCTGATAG AGTTCAACAG CTGCCAGATG
CTTTTCAGGA GAAGCAGACG CTACCTGGTT TTAAAACTTA CGGGATTAGT CAGCATGTTT CAACAAACTT GGAGAAAGGC
ACAGTACACG CCAGTCCTGT ATATATTCAC AAGAGAGAGA TTGACAAGAA TGATGGTCCT CATTCAGATG CCTACAAGGA
TATTGAATTG TGGATCTGTG GGAAATTAGT AGCTACTGCA ACGAGGAGCC CTAAGTGCAA TTGTATTGAT AAATCAGATG
TGGAAGATCA CATACATGTA TTTCTTGTCC CAAATGAAGT GGCTTCATCT GATTTTACAC AAGAGCTTCC TATCCTGGGA
ACTATTACTG GCTTGGCCAC CACTGGGGAG GAAGGATCTT GCTGTGTCTA TGATAGCCGT GGGATAAAGA CACATCTAAT
TGTCAAGCAC AGAACATTAA TGGTATGCAC AGCTGTCCAC ATTTATCACA TTTTTCTATA CACATTCAAA GTTTCTTTGG
TACATTGTGT AATACATATG ATCTGCCGAT GGAATTCAAG CACCCCCATC TTTAGCATGC ACTATCTATT GCTGTATAAC
TGTATGCAGT GCAACATTAA TCTTCAGACA CATACCGTGT TAAATGTTGA CTGTACTTCC TTTACAGGTC AAACACATGC
ACTGGTATCA AGTTGGAGAT GAAATTTCTC CATGTGAGTG TCGATGCAGT AGGGCTCGGT TGCCACCTAG TAGGTATGCT
TTCCTTTCTA TCTTCTTGTC TTGGCTGCAC TCACGCTGCA TGATCTTACA AATAGCATTG ATGAACTCAA GCCTTAAATG
TCATGGTCGT TTTGGGCTAA CTGGTTTAGA AATCATAATG CATATTGACA CTAATTTTAG CATGCTTTAT AAAGTCACTG
TTGTAAAAAA TATAACTTCA CTGCATCTGT TCTTATATCA AATGAATGAT ACAATCCTAT ACTTCTCCCT TCAAGGACCG
GAGAGGGCTA GCTTCGGATA GGTTTTGTGA TACTGTGGAA ATCTATCTGT ATACGGTTTG GTAATAACAA ACCACTTTTA
GCTGTAACAC TCCTCTTTTC AGATATTGGC TTTTTGAGCC TCGTTGTTAT ATGCATGACA CTGGTGGCTG GTACATTGAG
ACCTTTGGAA GGGACAAGAA AGGGAGGAAA ATTCTATCAC CAAGACAATG GGATGGTTCC AATGAACACT CTGAAAGGTG
CGCTCAGATT GTTTATAATG TTGTGTTACT ATCAAGTGGA AAGGATTTGG TAACTTTCCT TGAAAATGCA CATCTTTCTG
GATATTATAT TGCTTCAGCC TTGCTGCATT TAGTGGCTGA GAAAGCTAAT TTCCTAAAGT TTGCCATCTG TCTAGTTTTA
AAGTTAAAAT ACTGCCTTTC ACTATTTGTT TATGTAATAT GTTGTTGTCG TTGCAATTCA GCAGTCTACC TTTTTATCTA
ACAAATCCTC GTTGATGCTG AATGCATTGG AGTTTTTTAA AACTATTACT TTTTACATAA GGTTGGGTGG GGGTAAGCTT
TCCTTAATTG GTTGACAATT GCACAATTGC ATGTGCACTT GTTTTGATTT TTGCACGTAA GATTCTTTTC AAACCAAAAT
TTCAGGAGGT TGCATCCAGC AATGTATCTG GCAGCTCTAG CTTACAGATC TTTGGATATT GAGGATGCTC AACGAAAGAA
ATGGAGCATT ACGACCTTCC TGGAACTGCA GTCATCTCAT ATCTGTCAAT TGTGCAAAAA AATCTTCAAT GGGGGAAAGG
AAAGTTCATG AGAACACCAT GAGAAATGCA CAGCAGTTTC AAGAATTTGA TCTTTGACAA CTCTGATACT ATGATGCCAT
GCCTTGTTCA CCCGTTGATC ATATCCTTGA GATTTTGGTG TGGCTATGTA GCATCATGGC ACTGCACTGG AAGATATATA
GTGCACCTCT AGAATAAGCA AAATTATCTG AGGCTGTTCA TTGTGCTGAT TGTTGGATGT GGCACCCCTG GTCAATAGCT
TTTTTGCTGT GCTGATGTCA GAATTTCCAC ACCATTTGCT ATGAAAGGAC AGACATTATG GTAAATAAGC TAAACTGTTG
CATTTCTCTA CTATTTATAA TCTTCGCAAT TCTAAGTCTG TGCCCTTCAT TGATTATACT TGCACCTTGT AACCACGTAC
TGTTTGGATG AGCATTCAAC ACTACATACA ACTAAGGAAC CGTGCACATT ACAACGATAT GGTTCATAGC TGAAAGAAAG
CACCTAAAGT TTTGTAAACT CGTCTGTCTG CCATTTCTTT CTGGGAAAAA GGAATGGCTG GTTTGAACTC TTTTGGAGAA
GGGATGCTAC CTTAAACATT GGCAACACCA TCTGGTCATC TGTCATCATG CTCTTTTGTC TTAATCCACA AGAATGGTTC
GATAAGAGTA ACTTTATGTT ACTGCAGATG TATGCATTTT TTTTTTATAA ATGTTTTACA CCAGAACATG AACTAACTGT
CGCGCCGATA GAAAACTTGA AGACATGCTT GCCTGTTATT AAGTAGCAGA AATTTTACCC GAGTCCTACA GTTGCACATT
TGCAGTGGCA TGCACCTTCT CCATGGTTAT TGTTATCCAA CATTATGCAT GTATGTAATG GTACACATGT GTACATTTGC
AGTTTGCAAG AATTTTAATC CAAAATTACG TTGAATTGTT CTACAGGCTT CAGCCATGGC CAGTTAACTT GAAGTCTGTC
TTATGACCAA CGGGTGGGAA TATGGGAGAA AGTTAATAAT TACTTGGCTT CTCGACTGGA GTTTAATCTA CTTGGCATAT
TGATTTTATA TTAGGCGAGC ACCCTCTAAA TTTGGTGAAG GTGAGAGATG AAGCAGCCAC CGAGCTTAGC GTGAACATTC
TAAGGTAGTA TGTTATTCAG ATAATACGCA TATTCTCATA TACTTTTTTG AGTATTGTTA GCAAATTACA GGAAATTCCT
AGGATTATGT TTGATTGTTC TTCAAATTAG GGGAAAGCTC TGATTTATTT TTATTTTTTT AGAAAAGGGG AAAGCACTAT
GAAAAAGCAC CAGCAAGCAG CAACAGCTCT GCATGGAGAG GGATATTGTA TTTTCTTAGC CTCTTAGGTG TCGACTGAGT
TGCGCATGCT ATTGTGGGCA AGTTGTTTAT GTTTGAGACA ATGAATTTTG CTTCTATAGT TCCACCTGAT GGAAGACT

Locus: Os03g0761700

Loading...

Locus: Os03g0761700

Loading...