Os03t0761700-02

Locus

Os03g0761700

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjC34

Oryzabase Gene Name Synonym(s)

DnaJ domain protein C34

Transcript Evidence

AK289057 (DDBJ, Best hit)

Protein Evidence

NP_001051354.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, N-terminal (IPR001623)

Heat shock protein DnaJ (IPR003095)

Full-length cDNA

J090093G03 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0761700-02)

Others

Oryzabase (12191)

KEGG (Os03t0761700-02)

Transcript

2595 bp

>Os03t0761700-02 Hypothetical conserved gene.
GTCCTCCTCCGCGGCGAGGCGGCCCTTCCGCTCCCCCTCGCGTGGCGCGGCCGGCCGGTG
AGCACCGCCGCTCGCGACGACGAGCTCGCCGGGAAGAGCGCCTATGAGGTGCTCGGGGTC
GGGGAGACCAGCTCCTCCGCCGAGATCAAGGCCTCCTTCCACCGCCTCGCCAAGGAGACC
CACCCCGACGTCGCCGCCGCCGCCGGGTCCAGCCGCTTCCTTCAGATCCTCGCTGCCTAC
GAGATCCTATCGGATTCACAGAGAAGGGCTCACTATGATATCTACCTGCGATCGCAGAAG
CGAGTTTTGCAGAAGCATCCTAGGCCATCTCATCATGTATATCCAAATCCAAGTGGTTCA
GGCATTGTAGTAACAAGAGAAAGTAATGTTGTTGAGTGGCTAAAATGGTATAGGCTCACT
ATTGATGACATAGTTACAAAGAAGAGGGTTGCGACAGGGTCAGGTTACTTTGATAAGCTT
GAAAGTGAACTGTACACAGCAATCCATGCTGCATACTATGGTCCGGATGTTCGGTCTGTG
GATCTCCTTCCTGATTGCTTTGAAGCTGAGGAGAGAGTTCAACAGCTGCCAGATGCTTTT
CAGGAGAAGCAGACGCTACCTGGTTTTAAAACTTACGGGATTAGTCAGCATGTTTCAACA
AACTTGGAGAAAGGCACAGTACACGCCAGTCCTGTATATATTCACAAGAGAGAGATTGAC
AAGAATGATGGTCCTCATTCAGATGCCTACAAGGATATTGAATTGTGGATCTGTGGGAAA
TTAGTAGCTACTGCAACGAGGAGCCCTAAGTGCAATTGTATTGATAAATCAGATGTGGAA
GATCACATACATGTATTTCTTGTCCCAAATGAAGTGGCTTCATCTGATTTTACACAAGAG
CTTCCTATCCTGGGAACTATTACTGGCTTGGCCACCACTGGGGAGGAAGGATCTTGCTGT
GTCTATGATAGCCGTGGGATAAAGACACATCTAATTGTCAAGCACAGAACATTAATGGTC
AAACACATGCACTGGTATCAAGTTGGAGATGAAATTTCTCCATGTGAGTGTCGATGCAGT
AGGGCTCGGTTGCCACCTAGTAGATATTGGCTTTTTGAGCCTCGTTGTTATATGCATGAC
ACTGGTGGCTGGTACATTGAGACCTTTGGAAGGGACAAGAAAGGGAGGAAAATTCTATCA
CCAAGACAATGGGATGGTTCCAATGAACACTCTGAAAGGAGGTTGCATCCAGCAATGTAT
CTGGCAGCTCTAGCTTACAGATCTTTGGATATTGAGGATGCTCAACGAAAGAAATGGAGC
ATTACGACCTTCCTGGAACTGCAGTCATCTCATATCTGTCAATTGTGCAAAAAAATCTTC
AATGGGGGAAAGGAAAGTTCATGAGAACACCATGAGAAATGCACAGCAGTTTCAAGAATT
TGATCTTTGACAACTCTGATACTATGATGCCATGCCTTGTTCACCCGTTGATCATATCCT
TGAGATTTTGGTGTGGCTATGTAGCATCATGGCACTGCACTGGAAGATATATAGTGCACC
TCTAGAATAAGCAAAATTATCTGAGGCTGTTCATTGTGCTGATTGTTGGATGTGGCACCC
CTGGTCAATAGCTTTTTTGCTGTGCTGATGTCAGAATTTCCACACCATTTGCTATGAAAG
GACAGACATTATGGCTTCAGCCATGGCCAGTTAACTTGAAGTCTGTCTTATGACCAACGG
GTGGGAATATGGGAGAAAGTTAATAATTACTTGGCTTCTCGACTGGAGTTTAATCTACTT
GGCATATTGATTTTATATTAGGCGAGCACCCTCTAAATTTGGTGAAGGTGAGAGATGAAG
CAGCCACCGAGCTTAGCGTGAACATTCTAAGAAAAGGGGAAAGCACTATGAAAAAGCACC
AGCAAGCAGCAACAGCTCTGCATGGAGAGGGATATTGTATTTTCTTAGCCTCTTAGGTGT
CGACTGAGTTGCGCATGCTATTGTGGGCAAGTTGTTTATGTTTGAGACAATGAATTTTGC
TTCTATAGTTCCACCTGATGGAAGACTACACTTTGATCTCGGCACACTAACTCTCTGCAG
TTGACCTTCATACGGAAACTTTGGCTCTTCGGTAAAACTTAGTTCAAGAAGATAATAGAT
CTGTTAGTGTCTGGTTTAATCATTGTCTGGGAGGTACCAACTAGGCCATTATTCCCCAGG
AACCAATCTAGTCAAATACTTCATATGCTTGGAATTTTCTGAATTCACTGACCAAGAGAC
CTAAACATTTTCTGGAGAACACATGCTGATGCTGTGGTACACTAAGTTAATTCAAGTTCA
AAGTACTTGGTCTAGTTTGATGCTTCGTGATTGCATCCTGATGTTTATACATCACTGGTG
AAGAAAGTGCCAAAGTGTCTCATGTTCACGGGTTGGTTTCGAGTAGTACAGGTTTGTTGT
GTTCAGGACCCCAGGAGTTGCTTTTCACCATATGGATGCAATCATGTACATATGCCTTTT
CTTTTTGCCACAATAATCGTTGTAAGCTGTGGTTTCAGGCCCGTTCTTTGAAATTGAGAT
GACCAGCAATAGTGC

CDS

1404 bp

>Os03t0761700-02 Hypothetical conserved gene.
GTCCTCCTCCGCGGCGAGGCGGCCCTTCCGCTCCCCCTCGCGTGGCGCGGCCGGCCGGTG
AGCACCGCCGCTCGCGACGACGAGCTCGCCGGGAAGAGCGCCTATGAGGTGCTCGGGGTC
GGGGAGACCAGCTCCTCCGCCGAGATCAAGGCCTCCTTCCACCGCCTCGCCAAGGAGACC
CACCCCGACGTCGCCGCCGCCGCCGGGTCCAGCCGCTTCCTTCAGATCCTCGCTGCCTAC
GAGATCCTATCGGATTCACAGAGAAGGGCTCACTATGATATCTACCTGCGATCGCAGAAG
CGAGTTTTGCAGAAGCATCCTAGGCCATCTCATCATGTATATCCAAATCCAAGTGGTTCA
GGCATTGTAGTAACAAGAGAAAGTAATGTTGTTGAGTGGCTAAAATGGTATAGGCTCACT
ATTGATGACATAGTTACAAAGAAGAGGGTTGCGACAGGGTCAGGTTACTTTGATAAGCTT
GAAAGTGAACTGTACACAGCAATCCATGCTGCATACTATGGTCCGGATGTTCGGTCTGTG
GATCTCCTTCCTGATTGCTTTGAAGCTGAGGAGAGAGTTCAACAGCTGCCAGATGCTTTT
CAGGAGAAGCAGACGCTACCTGGTTTTAAAACTTACGGGATTAGTCAGCATGTTTCAACA
AACTTGGAGAAAGGCACAGTACACGCCAGTCCTGTATATATTCACAAGAGAGAGATTGAC
AAGAATGATGGTCCTCATTCAGATGCCTACAAGGATATTGAATTGTGGATCTGTGGGAAA
TTAGTAGCTACTGCAACGAGGAGCCCTAAGTGCAATTGTATTGATAAATCAGATGTGGAA
GATCACATACATGTATTTCTTGTCCCAAATGAAGTGGCTTCATCTGATTTTACACAAGAG
CTTCCTATCCTGGGAACTATTACTGGCTTGGCCACCACTGGGGAGGAAGGATCTTGCTGT
GTCTATGATAGCCGTGGGATAAAGACACATCTAATTGTCAAGCACAGAACATTAATGGTC
AAACACATGCACTGGTATCAAGTTGGAGATGAAATTTCTCCATGTGAGTGTCGATGCAGT
AGGGCTCGGTTGCCACCTAGTAGATATTGGCTTTTTGAGCCTCGTTGTTATATGCATGAC
ACTGGTGGCTGGTACATTGAGACCTTTGGAAGGGACAAGAAAGGGAGGAAAATTCTATCA
CCAAGACAATGGGATGGTTCCAATGAACACTCTGAAAGGAGGTTGCATCCAGCAATGTAT
CTGGCAGCTCTAGCTTACAGATCTTTGGATATTGAGGATGCTCAACGAAAGAAATGGAGC
ATTACGACCTTCCTGGAACTGCAGTCATCTCATATCTGTCAATTGTGCAAAAAAATCTTC
AATGGGGGAAAGGAAAGTTCATGA

Protein

468 aa

>Os03t0761700-02 Hypothetical conserved gene.
VLLRGEAALPLPLAWRGRPVSTAARDDELAGKSAYEVLGVGETSSSAEIKASFHRLAKET
HPDVAAAAGSSRFLQILAAYEILSDSQRRAHYDIYLRSQKRVLQKHPRPSHHVYPNPSGS
GIVVTRESNVVEWLKWYRLTIDDIVTKKRVATGSGYFDKLESELYTAIHAAYYGPDVRSV
DLLPDCFEAEERVQQLPDAFQEKQTLPGFKTYGISQHVSTNLEKGTVHASPVYIHKREID
KNDGPHSDAYKDIELWICGKLVATATRSPKCNCIDKSDVEDHIHVFLVPNEVASSDFTQE
LPILGTITGLATTGEEGSCCVYDSRGIKTHLIVKHRTLMVKHMHWYQVGDEISPCECRCS
RARLPPSRYWLFEPRCYMHDTGGWYIETFGRDKKGRKILSPRQWDGSNEHSERRLHPAMY
LAALAYRSLDIEDAQRKKWSITTFLELQSSHICQLCKKIFNGGKESS*

CDS

chr03:31495998..31496240 (+ strand) : 243 bp

chr03:31496451..31496782 (+ strand) : 332 bp

chr03:31496861..31497302 (+ strand) : 442 bp

chr03:31497508..31497593 (+ strand) : 86 bp

chr03:31497943..31498077 (+ strand) : 135 bp

chr03:31498486..31498651 (+ strand) : 166 bp

3'UTR

chr03:31498652..31498940 (+ strand) : 289 bp

chr03:31499567..31499764 (+ strand) : 198 bp

chr03:31499903..31500606 (+ strand) : 704 bp

FASTA

>Os03t0761700-02 class=Sequence position=chr03:31495998..31500606 (+ strand)
GTCCTCCTCC GCGGCGAGGC GGCCCTTCCG CTCCCCCTCG CGTGGCGCGG CCGGCCGGTG AGCACCGCCG CTCGCGACGA
CGAGCTCGCC GGGAAGAGCG CCTATGAGGT GCTCGGGGTC GGGGAGACCA GCTCCTCCGC CGAGATCAAG GCCTCCTTCC
ACCGCCTCGC CAAGGAGACC CACCCCGACG TCGCCGCCGC CGCCGGGTCC AGCCGCTTCC TTCAGATCCT CGCTGCCTAC
GAGGTGTTCA TTCGATTCAC TTGGCTACTT AGATAAGGGA ATGGGGCTAC TAATGGGTAA TTGGGGGTAT CATGAGTGCA
AACTTTCAAA CCCTACCATA TGATTATAAT TGTTATGATT GTAGTATTGA TAAATTGAGG GGGCAAGACT TTGTACTATG
AAGGAATCAA AACATGGAGA AATTTAATGG TTAACAATAT TGTTATGTTG CAGATCCTAT CGGATTCACA GAGAAGGGCT
CACTATGATA TCTACCTGCG ATCGCAGAAG CGAGTTTTGC AGAAGCATCC TAGGCCATCT CATCATGTAT ATCCAAATCC
AAGTGGTTCA GGCATTGTAG TAACAAGAGA AAGTAATGTT GTTGAGTGGC TAAAATGGTA TAGGCTCACT ATTGATGACA
TAGTTACAAA GAAGAGGGTT GCGACAGGGT CAGGTTACTT TGATAAGCTT GAAAGTGAAC TGTACACAGC AATCCATGCT
GCATACTATG GTCCGGATGT TCGGTCTGTG GATCTCCTTC CTGATTGCTT TGAAGCTGAG GAGAGGTCTG TATATGAGAC
CCCTGAGCTA TTGCACCTTG TATCGGGTCG TGATCTGTTT GGTATTGTTA GTCTAGCTGA TAGAGTTCAA CAGCTGCCAG
ATGCTTTTCA GGAGAAGCAG ACGCTACCTG GTTTTAAAAC TTACGGGATT AGTCAGCATG TTTCAACAAA CTTGGAGAAA
GGCACAGTAC ACGCCAGTCC TGTATATATT CACAAGAGAG AGATTGACAA GAATGATGGT CCTCATTCAG ATGCCTACAA
GGATATTGAA TTGTGGATCT GTGGGAAATT AGTAGCTACT GCAACGAGGA GCCCTAAGTG CAATTGTATT GATAAATCAG
ATGTGGAAGA TCACATACAT GTATTTCTTG TCCCAAATGA AGTGGCTTCA TCTGATTTTA CACAAGAGCT TCCTATCCTG
GGAACTATTA CTGGCTTGGC CACCACTGGG GAGGAAGGAT CTTGCTGTGT CTATGATAGC CGTGGGATAA AGACACATCT
AATTGTCAAG CACAGAACAT TAATGGTATG CACAGCTGTC CACATTTATC ACATTTTTCT ATACACATTC AAAGTTTCTT
TGGTACATTG TGTAATACAT ATGATCTGCC GATGGAATTC AAGCACCCCC ATCTTTAGCA TGCACTATCT ATTGCTGTAT
AACTGTATGC AGTGCAACAT TAATCTTCAG ACACATACCG TGTTAAATGT TGACTGTACT TCCTTTACAG GTCAAACACA
TGCACTGGTA TCAAGTTGGA GATGAAATTT CTCCATGTGA GTGTCGATGC AGTAGGGCTC GGTTGCCACC TAGTAGGTAT
GCTTTCCTTT CTATCTTCTT GTCTTGGCTG CACTCACGCT GCATGATCTT ACAAATAGCA TTGATGAACT CAAGCCTTAA
ATGTCATGGT CGTTTTGGGC TAACTGGTTT AGAAATCATA ATGCATATTG ACACTAATTT TAGCATGCTT TATAAAGTCA
CTGTTGTAAA AAATATAACT TCACTGCATC TGTTCTTATA TCAAATGAAT GATACAATCC TATACTTCTC CCTTCAAGGA
CCGGAGAGGG CTAGCTTCGG ATAGGTTTTG TGATACTGTG GAAATCTATC TGTATACGGT TTGGTAATAA CAAACCACTT
TTAGCTGTAA CACTCCTCTT TTCAGATATT GGCTTTTTGA GCCTCGTTGT TATATGCATG ACACTGGTGG CTGGTACATT
GAGACCTTTG GAAGGGACAA GAAAGGGAGG AAAATTCTAT CACCAAGACA ATGGGATGGT TCCAATGAAC ACTCTGAAAG
GTGCGCTCAG ATTGTTTATA ATGTTGTGTT ACTATCAAGT GGAAAGGATT TGGTAACTTT CCTTGAAAAT GCACATCTTT
CTGGATATTA TATTGCTTCA GCCTTGCTGC ATTTAGTGGC TGAGAAAGCT AATTTCCTAA AGTTTGCCAT CTGTCTAGTT
TTAAAGTTAA AATACTGCCT TTCACTATTT GTTTATGTAA TATGTTGTTG TCGTTGCAAT TCAGCAGTCT ACCTTTTTAT
CTAACAAATC CTCGTTGATG CTGAATGCAT TGGAGTTTTT TAAAACTATT ACTTTTTACA TAAGGTTGGG TGGGGGTAAG
CTTTCCTTAA TTGGTTGACA ATTGCACAAT TGCATGTGCA CTTGTTTTGA TTTTTGCACG TAAGATTCTT TTCAAACCAA
AATTTCAGGA GGTTGCATCC AGCAATGTAT CTGGCAGCTC TAGCTTACAG ATCTTTGGAT ATTGAGGATG CTCAACGAAA
GAAATGGAGC ATTACGACCT TCCTGGAACT GCAGTCATCT CATATCTGTC AATTGTGCAA AAAAATCTTC AATGGGGGAA
AGGAAAGTTC ATGAGAACAC CATGAGAAAT GCACAGCAGT TTCAAGAATT TGATCTTTGA CAACTCTGAT ACTATGATGC
CATGCCTTGT TCACCCGTTG ATCATATCCT TGAGATTTTG GTGTGGCTAT GTAGCATCAT GGCACTGCAC TGGAAGATAT
ATAGTGCACC TCTAGAATAA GCAAAATTAT CTGAGGCTGT TCATTGTGCT GATTGTTGGA TGTGGCACCC CTGGTCAATA
GCTTTTTTGC TGTGCTGATG TCAGAATTTC CACACCATTT GCTATGAAAG GACAGACATT ATGGTAAATA AGCTAAACTG
TTGCATTTCT CTACTATTTA TAATCTTCGC AATTCTAAGT CTGTGCCCTT CATTGATTAT ACTTGCACCT TGTAACCACG
TACTGTTTGG ATGAGCATTC AACACTACAT ACAACTAAGG AACCGTGCAC ATTACAACGA TATGGTTCAT AGCTGAAAGA
AAGCACCTAA AGTTTTGTAA ACTCGTCTGT CTGCCATTTC TTTCTGGGAA AAAGGAATGG CTGGTTTGAA CTCTTTTGGA
GAAGGGATGC TACCTTAAAC ATTGGCAACA CCATCTGGTC ATCTGTCATC ATGCTCTTTT GTCTTAATCC ACAAGAATGG
TTCGATAAGA GTAACTTTAT GTTACTGCAG ATGTATGCAT TTTTTTTTTA TAAATGTTTT ACACCAGAAC ATGAACTAAC
TGTCGCGCCG ATAGAAAACT TGAAGACATG CTTGCCTGTT ATTAAGTAGC AGAAATTTTA CCCGAGTCCT ACAGTTGCAC
ATTTGCAGTG GCATGCACCT TCTCCATGGT TATTGTTATC CAACATTATG CATGTATGTA ATGGTACACA TGTGTACATT
TGCAGTTTGC AAGAATTTTA ATCCAAAATT ACGTTGAATT GTTCTACAGG CTTCAGCCAT GGCCAGTTAA CTTGAAGTCT
GTCTTATGAC CAACGGGTGG GAATATGGGA GAAAGTTAAT AATTACTTGG CTTCTCGACT GGAGTTTAAT CTACTTGGCA
TATTGATTTT ATATTAGGCG AGCACCCTCT AAATTTGGTG AAGGTGAGAG ATGAAGCAGC CACCGAGCTT AGCGTGAACA
TTCTAAGGTA GTATGTTATT CAGATAATAC GCATATTCTC ATATACTTTT TTGAGTATTG TTAGCAAATT ACAGGAAATT
CCTAGGATTA TGTTTGATTG TTCTTCAAAT TAGGGGAAAG CTCTGATTTA TTTTTATTTT TTTAGAAAAG GGGAAAGCAC
TATGAAAAAG CACCAGCAAG CAGCAACAGC TCTGCATGGA GAGGGATATT GTATTTTCTT AGCCTCTTAG GTGTCGACTG
AGTTGCGCAT GCTATTGTGG GCAAGTTGTT TATGTTTGAG ACAATGAATT TTGCTTCTAT AGTTCCACCT GATGGAAGAC
TACACTTTGA TCTCGGCACA CTAACTCTCT GCAGTTGACC TTCATACGGA AACTTTGGCT CTTCGGTAAA ACTTAGTTCA
AGAAGATAAT AGATCTGTTA GTGTCTGGTT TAATCATTGT CTGGGAGGTA CCAACTAGGC CATTATTCCC CAGGAACCAA
TCTAGTCAAA TACTTCATAT GCTTGGAATT TTCTGAATTC ACTGACCAAG AGACCTAAAC ATTTTCTGGA GAACACATGC
TGATGCTGTG GTACACTAAG TTAATTCAAG TTCAAAGTAC TTGGTCTAGT TTGATGCTTC GTGATTGCAT CCTGATGTTT
ATACATCACT GGTGAAGAAA GTGCCAAAGT GTCTCATGTT CACGGGTTGG TTTCGAGTAG TACAGGTTTG TTGTGTTCAG
GACCCCAGGA GTTGCTTTTC ACCATATGGA TGCAATCATG TACATATGCC TTTTCTTTTT GCCACAATAA TCGTTGTAAG
CTGTGGTTTC AGGCCCGTTC TTTGAAATTG AGATGACCAG CAATAGTGC

Locus: Os03g0761700

Loading...

Locus: Os03g0761700

Loading...