Os03t0762000-01

Locus

Os03g0762000

Description

Similar to Protein kinase CK2, alpha subunit.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HD6

CGSNL Gene Name

HEADING DATE 6

Oryzabase Gene Symbol Synonym(s)

Hd6(t)*, OSCKA2, OsCKA2, CKA2, OsCKA2-1, CKA2-1, Hd6/CK2alpha, CK2alpha

Oryzabase Gene Name Synonym(s)

Heading date (QTL)-6(t), Heading date-6, Heading date6, casein kinase II alpha subunit, CK2alpha subunit 1, Casein Kinase 2alpha

Transcript Evidence

CT837832 (DDBJ, Best hit)

Protein Evidence

Q9ST47 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Expression Databases

TENOR (Os03t0762000-01)

Others

Oryzabase (529)

Transcript

767 bp

>Os03t0762000-01 Similar to Protein kinase CK2, alpha subunit.
ATTCTCTCTCCCCCACCCCCGAAACCCTAGCGCGACCTCGCCGCCGGCAATGGCCGCATG
ACCGATGCGCCTCCGCCGAGGAGCCGCCCGCACCCACCCAGCAGCAGCGTCGCCGTGCCC
GCCGCCGCGGCGGCAGTGATCGCAGCCGCCCTCGCGTCCTCCTTCCTCGCCCTGCTGCAG
CCGCCCCGGCGCGCCCCGGTCGCCGCGGGATCCAGGGTCGGCATGTCGAAGGCGAGGGTC
TACGCCGACGTCAACGTGCTGCGCCCCAAGGAGTACTGGGACTACGAGGCGCTCACCGTT
CAATGGGGTGAGCAGGATGACTATGAAGTTGTCAGGAAAGTTGGAAGAGGTAAATATAGT
GAAGTCTTTGAAGGCATCAATGTTAACAACAATGAGAAATGCATCATCAAGATACTCAAG
CCTGTGAAGAAAAAGAAGATCAAAAGGGAGATTAAAATACTTCAGAATCTTTGTGGAGGT
CCAAACATTGTGTAGCTTCTTGATATTGTCAGAGATCAACATTCTAAGACTCCTAGCTTG
ATCTTTGAATATGTCAACAATACAGACTTCAAAGTGCTGTACCCCACGTTGACAGATTAT
GATATCCGCTACTACATATATGAGCTACTCAAGGCATTAGACTACTGCCATTCACAAGGC
ATTATGCATCGAGATGTCAAGCCCCACAATGTTATGATAGATCATGAGCTCCGAAAACTT
CGATTGATAGACTGGGGCCTGGCTGAGTTCTATCATCCAGGGAAGGA

CDS

438 bp

>Os03t0762000-01 Similar to Protein kinase CK2, alpha subunit.
ATGACCGATGCGCCTCCGCCGAGGAGCCGCCCGCACCCACCCAGCAGCAGCGTCGCCGTG
CCCGCCGCCGCGGCGGCAGTGATCGCAGCCGCCCTCGCGTCCTCCTTCCTCGCCCTGCTG
CAGCCGCCCCGGCGCGCCCCGGTCGCCGCGGGATCCAGGGTCGGCATGTCGAAGGCGAGG
GTCTACGCCGACGTCAACGTGCTGCGCCCCAAGGAGTACTGGGACTACGAGGCGCTCACC
GTTCAATGGGGTGAGCAGGATGACTATGAAGTTGTCAGGAAAGTTGGAAGAGGTAAATAT
AGTGAAGTCTTTGAAGGCATCAATGTTAACAACAATGAGAAATGCATCATCAAGATACTC
AAGCCTGTGAAGAAAAAGAAGATCAAAAGGGAGATTAAAATACTTCAGAATCTTTGTGGA
GGTCCAAACATTGTGTAG

Protein

146 aa

>Os03t0762000-01 Similar to Protein kinase CK2, alpha subunit.
MTDAPPPRSRPHPPSSSVAVPAAAAAVIAAALASSFLALLQPPRRAPVAAGSRVGMSKAR
VYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKIL
KPVKKKKIKREIKILQNLCGGPNIV*

5'UTR

chr03:31514342..31514398 (- strand) : 57 bp

CDS

chr03:31514091..31514341 (- strand) : 251 bp

chr03:31512595..31512724 (- strand) : 130 bp

chr03:31512458..31512514 (- strand) : 57 bp

3'UTR

chr03:31512320..31512457 (- strand) : 138 bp

chr03:31511520..31511653 (- strand) : 134 bp

FASTA

>Os03t0762000-01 class=Sequence position=chr03:31511520..31514398 (- strand)
ATTCTCTCTC CCCCACCCCC GAAACCCTAG CGCGACCTCG CCGCCGGCAA TGGCCGCATG ACCGATGCGC CTCCGCCGAG
GAGCCGCCCG CACCCACCCA GCAGCAGCGT CGCCGTGCCC GCCGCCGCGG CGGCAGTGAT CGCAGCCGCC CTCGCGTCCT
CCTTCCTCGC CCTGCTGCAG CCGCCCCGGC GCGCCCCGGT CGCCGCGGGA TCCAGGGTCG GCATGTCGAA GGCGAGGGTC
TACGCCGACG TCAACGTGCT GCGCCCCAAG GAGTACTGGG ACTACGAGGC GCTCACCGTT CAATGGGGGT AGGTAGCACA
GCCAGCCAGC TGACGTCACC TTCCTGAGCC CCCTGATCAG CGGCCGTAGC TTGTATTCTC CAGATTTAGT TCGCGATCCG
TATCCCGTAC ACCTGGGCTG GGTTTGCTTA TTGGGATTAG GTTGGATTAT TGGGTTATGC GTAGGTTTGC TTGTGCCTGT
AGATTTTGGT TTTGGTCAGG GAATTGGGAA TTTATTGTAG CTTGAAGGTT AGATTGAATT GCTTCTGTTT CTATTAGGAC
GAACTCAATA CCGAAGACTG CTTTGGTAGT TTTACATGTT TGTACTATAG GAGTAGGGGA CACATGTTTA CCGAATGGTT
GAAGAAATTG TTATGAATTT GCAAGGTTAT GATTTTAATT TTGGAATCAA TCTCACTATA TCTTCCTTTT AAAGTTGATA
CTAGTGTTGT TCAGTTAAGA GCCTTTGTTT GATTGTGAAT GGCAAGCTGT AGGTATTGAT CCTATTTTTG TTGGGGATAA
AATCTAAGTT AAGGCAAAAT TAGGCAGTTT TATGTTTAAT CATTGGAACA AAGTAAGTTG GTGATGGGTT TCTGGGTGTT
TCTTTTGCAT CATCTGATAA CCAAGATTGA TGAGTAAAGC ATAACTTGGT AGTATAGTGC TTTGGGCCTA ATCTTCTTTA
GCACTGAACA TTCACCAAGT TCTATGCTTT TATGTAATCT CAAATTTAAC ATTGTGTTTT CCTTCACTCA CCCTAGAATA
TACTACCTGA AAGCAATCAA TGAAATCAAA TATAACTTCG TTTCTACCTA TATGATTGTA ACATGCTGAG TAATATGGTG
CCAAACAACT CAACACATAT AATACTGTCC TTAACAACCC ATCTTCTTTT CCCTGTAGAA GTTACAGCCC TAGTATATTC
TGTACATGTC ATGCTACCTA GATGACAGTT GAGGCCTGGT AGGAGTGTGC TTGTTTAATT TTGGTACTCC AAAAGTGCAC
TGTTTTTCTC AATCTGACTC TGTTACCAGT TGTGTTTCCT CTAGATGTAT TCCTTATCTA TGGTGAATTA TTAAATAAGT
TGTCTGGTGA CAAAAAAAAA AGAAAAATAA AAGAAGAGAT GAACAATATG TAGCTCATTG ATGATCCCTT GTCTGCTTGA
ACTTTATGAG AAACTATAGA AAGCAGTGGT GTTTTCCCTG ACCTGATGTT AAATACTTGT TAAGAATTGA GCTTTCTTCG
AAGTTTGTTC AGTTTACACA CCAACACTAA GAATTGCCAT ATATCTCCCA TCTTTTGTCC ATTTAATTCT TGTTACCTCA
AGTCATTGAG GGACCTGGCA GCATGTTATG ACTTACACAA TACCTCGCTA ACTATTATGG TGCATCTTTA ACAGTGAGCA
GGATGACTAT GAAGTTGTCA GGAAAGTTGG AAGAGGTAAA TATAGTGAAG TCTTTGAAGG CATCAATGTT AACAACAATG
AGAAATGCAT CATCAAGATA CTCAAGCCTG TGAAGAAAAA GAAGGTATTT AATTGATCTT ATTGACTGTT TTTTTTAATT
GCTAGTGTTG AAGTTCTTAA CCTACCTTTC ATATGTTTGA ACAGATCAAA AGGGAGATTA AAATACTTCA GAATCTTTGT
GGAGGTCCAA ACATTGTGTA GCTTCTTGAT ATTGTCAGAG ATCAACATTC TAAGACTCCT AGCTTGATCT TTGAATATGT
CAACAATACA GACTTCAAAG TGCTGTACCC CACGTTGACA GATTATGATA TCCGCTACTA CATATATGAG CTACTCAAGG
TCTTCATTGA GCCTTCATTG TCATCCCTAT TTATTTACTC TATTCAGTAA AACATCCTGT TCTGTGGATC TGTAGAATGA
TGTATCTCTT ATAGAAATTG TTTCACAATT ACTTTCCTAT TATGTGAAGA TCCAACTAAA CACACTTGTA ATATATCCTA
GACAAATATC ACCATTCTCA CTGCTTGCAA GTTGCAACAT ATCTTTAATT ATTTATGTAT ATATGAACTT GATTATTTTC
TAAGTTACAT GGCTTAAAAC TTGTCACAAT CTCAAGCAGT TTATGGATCA GTTTTGTTTT GAGTTTTAAT TATAGTAGCA
TCTTGCACTT CATAATGTAC AGATGACAAA AGAATTCCTG AATTGCATAT GTGCTATAAT GGTTTATGAT CTGGGATTTT
GAAGAGAAGT GTCGTTTTAT ACATTTCTAA GTTCAGCACT ATGTTGGTGT TAAGAATTCA GCCATCAATG GGCATCTTAA
CGTATGTGCT AGGTCATGCC TTCTATCCAT GGGTAATAAA CTGTTAACAC ACAGTGTGTG TTTTTCATAT CGATATTCTT
AGCCAAGAAC AGTAGCATCA TTTGCCCTTA ATCCTGTGTG TTAAGTTTGT TTAAAGAATC TAGTTGATTT TCTTTACAAT
ATTTTCCTTC TGTTTATGGC CCCAGGCATT AGACTACTGC CATTCACAAG GCATTATGCA TCGAGATGTC AAGCCCCACA
ATGTTATGAT AGATCATGAG CTCCGAAAAC TTCGATTGAT AGACTGGGGC CTGGCTGAGT TCTATCATCC AGGGAAGGA