Os03t0760600-01

Locus

Os03g0760600

Description

TIP41-like protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK103511 (DDBJ, Best hit)

Protein Evidence

E9P1K9 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

TIP41-like protein (IPR007303)

Full-length cDNA

J033131F13 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0760600-01)

RiceXPro (AK103511)

Others

KEGG (Os03t0760600-01)

Transcript

1276 bp

>Os03t0760600-01 TIP41-like protein family protein.
GGGCTCGCCTCTCGACCTCGGTGTTGCGCTCTCCTCCGCTCGGACCGCTCCTCGCCGGCG
ATCCCCCCGCCTCCACCGCCGCCGCCGCCGCCGCCGTCGATCTGCGCTGCCACGGCCGGG
GGGGAAGCTTGTGCTGAGGCGCAGTCCTGAAGAGAACCCCACTTGGGAGGCCGGGGGGCG
TCGAAGCTCCAAACAACCAAGCACCATCGTGACGAAGCACGCCACGGGAGATGACTAAGG
CGGCGGAGGCGTGGGAGGGCCCGACGGCGGCGGAGCTGAAGGCGGCCGGCGCGGAGGCGA
TCCCCGGCGGGGTGCGGGTGAAGGGGTGGGTCATCCGGTCCCACAACGGCCCCATCCTCA
ACTCCGCCTCGCTCCAGCTCTTTGAAGATAAACTTCAGACAACACATTTACCTGAGATGG
TTTTTGGGGAGAGTTTCTTATCTCTTCAGCATGCTCAAACTGGCATTAGATTATATTTCA
ATGCGCTTGATGCTCTGAAGGCATGGAAACATGAAGCACTACCACCTGTTGAAGTTCCTG
CGGCAGCAAAGTGGAAGTTCAGGAGTAAGCCTTCTGATCAAGTAATACTTGATTATGACT
ATACATTCACGACACCGTACAATGGGAGTGATGCTTTGGTTCAGAACCCAGATAGTATTC
AAACAAGTTTGGATGAACCCCGCAATTTGTGTTGGGAGGATTCTGAGGATCGGATTGACC
TTGTTGCCCTTTCAGCAAAAGAACCAATTCTTTTCTATGACGAGGTTATCCTGTATGAAG
ATGAGTTAGCCGATAATGGCATTTCATTCCTCACTGTGCGAGTGAGGGTGATGCCAACTG
GTTGGTTCCTGCTCTTGCGTTTTTGGCTTAGGGTTGATGGTGTACTTATGAGATTGAGGG
ATACCCGGGTGTATTGCTCTTTTGGTAGTGACGAAGCAAAACCCATTGTACTGCGTGAAT
GCTGCTGGAGGGAAGCAACATTTGCTAGTCTGTCTGCGAAGGGATACCCTTCCGACTCTG
CAGCATATGGAGACCCGAATCTTATTGCTCATAAGCTTCCAGTTGTGATGCAGAAGATCC
AAAAGCTGAAATTACCCAATTAACCCGACAACCCATCTCGTGTACATCAGCGTTTTTTTT
TTCCATTGACTGTTGGACGGTGTTCTCTTTCTGCTTATCATGTGCTGTGGTCTGTGGATG
CACGTTCCTGTAGCTGGCAATAGTATAAAAATTCTTGTGGTAAAGGCTATTTGTCTACTG
GGGCTTATCAGCTTTT

CDS

873 bp

>Os03t0760600-01 TIP41-like protein family protein.
ATGACTAAGGCGGCGGAGGCGTGGGAGGGCCCGACGGCGGCGGAGCTGAAGGCGGCCGGC
GCGGAGGCGATCCCCGGCGGGGTGCGGGTGAAGGGGTGGGTCATCCGGTCCCACAACGGC
CCCATCCTCAACTCCGCCTCGCTCCAGCTCTTTGAAGATAAACTTCAGACAACACATTTA
CCTGAGATGGTTTTTGGGGAGAGTTTCTTATCTCTTCAGCATGCTCAAACTGGCATTAGA
TTATATTTCAATGCGCTTGATGCTCTGAAGGCATGGAAACATGAAGCACTACCACCTGTT
GAAGTTCCTGCGGCAGCAAAGTGGAAGTTCAGGAGTAAGCCTTCTGATCAAGTAATACTT
GATTATGACTATACATTCACGACACCGTACAATGGGAGTGATGCTTTGGTTCAGAACCCA
GATAGTATTCAAACAAGTTTGGATGAACCCCGCAATTTGTGTTGGGAGGATTCTGAGGAT
CGGATTGACCTTGTTGCCCTTTCAGCAAAAGAACCAATTCTTTTCTATGACGAGGTTATC
CTGTATGAAGATGAGTTAGCCGATAATGGCATTTCATTCCTCACTGTGCGAGTGAGGGTG
ATGCCAACTGGTTGGTTCCTGCTCTTGCGTTTTTGGCTTAGGGTTGATGGTGTACTTATG
AGATTGAGGGATACCCGGGTGTATTGCTCTTTTGGTAGTGACGAAGCAAAACCCATTGTA
CTGCGTGAATGCTGCTGGAGGGAAGCAACATTTGCTAGTCTGTCTGCGAAGGGATACCCT
TCCGACTCTGCAGCATATGGAGACCCGAATCTTATTGCTCATAAGCTTCCAGTTGTGATG
CAGAAGATCCAAAAGCTGAAATTACCCAATTAA

Protein

290 aa

>Os03t0760600-01 TIP41-like protein family protein.
MTKAAEAWEGPTAAELKAAGAEAIPGGVRVKGWVIRSHNGPILNSASLQLFEDKLQTTHL
PEMVFGESFLSLQHAQTGIRLYFNALDALKAWKHEALPPVEVPAAAKWKFRSKPSDQVIL
DYDYTFTTPYNGSDALVQNPDSIQTSLDEPRNLCWEDSEDRIDLVALSAKEPILFYDEVI
LYEDELADNGISFLTVRVRVMPTGWFLLLRFWLRVDGVLMRLRDTRVYCSFGSDEAKPIV
LRECCWREATFASLSAKGYPSDSAAYGDPNLIAHKLPVVMQKIQKLKLPN*

5'UTR

chr03:31458636..31458865 (- strand) : 230 bp

CDS

chr03:31458487..31458635 (- strand) : 149 bp

chr03:31457622..31457807 (- strand) : 186 bp

chr03:31457191..31457281 (- strand) : 91 bp

chr03:31456966..31457073 (- strand) : 108 bp

chr03:31456762..31456821 (- strand) : 60 bp

chr03:31456618..31456659 (- strand) : 42 bp

chr03:31456131..31456262 (- strand) : 132 bp

chr03:31455923..31456027 (- strand) : 105 bp

3'UTR

chr03:31455750..31455922 (- strand) : 173 bp

FASTA

>Os03t0760600-01 class=Sequence position=chr03:31455750..31458865 (- strand)
GGGCTCGCCT CTCGACCTCG GTGTTGCGCT CTCCTCCGCT CGGACCGCTC CTCGCCGGCG ATCCCCCCGC CTCCACCGCC
GCCGCCGCCG CCGCCGTCGA TCTGCGCTGC CACGGCCGGG GGGGAAGCTT GTGCTGAGGC GCAGTCCTGA AGAGAACCCC
ACTTGGGAGG CCGGGGGGCG TCGAAGCTCC AAACAACCAA GCACCATCGT GACGAAGCAC GCCACGGGAG ATGACTAAGG
CGGCGGAGGC GTGGGAGGGC CCGACGGCGG CGGAGCTGAA GGCGGCCGGC GCGGAGGCGA TCCCCGGCGG GGTGCGGGTG
AAGGGGTGGG TCATCCGGTC CCACAACGGC CCCATCCTCA ACTCCGCCTC GCTCCAGCTG TACGATCCAC TCCCCATCTT
AAACCCTAAC CTTTTTTTTT CTGCTCTTTG TTACTTTGAT TCGCTGGGTA GAAATTTTTA CATTAATATT AGGTAGAACA
TTACAGTAAA CTATTTCTAC TTATGTTTCA AAATTTCTGC GTTTATTATG GCACTGAATT GTGCATACTT CTAAATGGAT
CATATGGAAC CTGAATTCTG TATCCGCCAC AATATCTTCA TCATTAGCTA AAAACTGGTA CTTAAGCTCG TTTACTTGAG
TGTAAATTGT GTATATATCG AAATACTCAT GAGAAACGAG AAGGTGAAAA CTAATCGAAC TGGTGAGGAA ACAGGGTGGA
ATGTAGAGAT GGAACTATGA AAGAATGAGA ATACACACAT TGGGAATATT AAGTATCTGT GAACAAATAA GTATTCGTGA
ATTGAGTAAA TGAGTAATGA ATAATGCTAG CCTACCATTC ATTCTGTTGG TATGCTTGGT CAGACAATCT CTGTAACATA
TTCCAGTTTA TGTTGATTTA TCATATAAAA GAGTTTATTC TGCATAAATA CAGATATTGG ATCTCTCCAC TGGTTGTAAA
TCATTGACTT GCCAGCATAG GGAAGAATTT TACATGAATT AATTGAGATT TAGAGATAAA GAAAACTGGT TTGTAATATG
CTTTCTTCTT TTCTTCAGCT TTGAAGATAA ACTTCAGACA ACACATTTAC CTGAGATGGT TTTTGGGGAG AGTTTCTTAT
CTCTTCAGCA TGCTCAAACT GGCATTAGAT TATATTTCAA TGCGCTTGAT GCTCTGAAGG CATGGAAACA TGAAGCACTA
CCACCTGTTG AAGTTCCTGC GGCAGCAAAG TGGAAGTTCA GGAGGTTCTT CTATAACTCT GTTTTATCAC TTATAAAGTT
ATACTCGATG CATGCTAGGA AGTGTTTCTA GTGAAAACCG TTGGATTTTC CTGGTGTGAC CTTTATTATA TAGTCCCATG
TATGAATGCC ATAAAAAAAT TGAGATGACT TTGTTTACTT TTTACTGTAC AAACTGCCAG GATGCTTGTA TTATTTTTAT
GCCCGTTTTA GTCTGTCATA AGAGTTTTAT AGCACATGCC TGTAATTTCT TTCCTTCTAG AATCATTTAA GGAAAGAAAT
GATGTGCTCT GGATTTATTA ATGAGAAAAC TAAGAGCAAG TTTGCGGTGG GTGTTTTCAT GCAGTAAGCC TTCTGATCAA
GTAATACTTG ATTATGACTA TACATTCACG ACACCGTACA ATGGGAGTGA TGCTTTGGTT CAGAACCCAG ATAGTGTATG
TGCCTTATCT CTGTACTATA TCAGTTTCAC CTGTGGCCTT AAGTTGTCCT GTTGTCTTAC TAGTTGGTAT CACATTCAGA
CAAATACTTT CTTTTTCCCA TGCCTTCTCC AGATTCAAAC AAGTTTGGAT GAACCCCGCA ATTTGTGTTG GGAGGATTCT
GAGGATCGGA TTGACCTTGT TGCCCTTTCA GCAAAAGAAC CAATTCTTTT CTATGACGAG GTATGAAAAT GAAAAAAATT
ATCCATGCTT GCTCTATAGT CTACATCTCA CAAAATATAT TTAGGTTATC CTGTATGAAG ATGAGTTAGC CAATAATGGC
ATTTCATTCC TCACTATAGT CTACATCTCA CAAAATATAT TTAGGTTATC CTGTATGAAG ATGAGTTAGC CGATAATGGC
ATTTCATTCC TCACTGTGCG AGTGGTAAGT GTTTTTCTAA CTAACCTTGT TTCTAATTGG ACTATATGTA TGGGTAAAGC
AACTTTTAGT CAATACTAAA TATGATCTTC GATTGCATTT CTACAGAGGG TGATGCCAAC TGGTTGGTTC CTGCTCTTGC
GTTTTTGGGT ATGATCTGCT GCCTGTATTA TATAACTTGT GCTTGTTTAG TACGAATATA ATCTTTTGAG GACAATAGTA
AGCAAATATC TAAACAGTGA TTTTCTAATA GTCCAGTTTT TTAAGAAAGA AATTATGCAA ACAAAGTTTA GTCCTCAGTG
TAGTAGTAGT TACAAACTAC TTTACTCTTC CTGTCGTGAC AGAACTTTAT TTACTCTGAA ATCTAGGAGA CACTTTTGAA
AGGGCTCGAA ATTCCAAAGC TAGTATTTAT GCTCAAAAGA CAACCTACAA GCAGCTGTAA CTTTGGGTTG AAAGACTGCA
ATGGCACTAT CATAACAGCG TTTTCCCTCC TTTGTGTTAA CAGCTTAGGG TTGATGGTGT ACTTATGAGA TTGAGGGATA
CCCGGGTGTA TTGCTCTTTT GGTAGTGACG AAGCAAAACC CATTGTACTG CGTGAATGCT GCTGGAGGGA AGCAACATTT
GCTAGTCTGT CTGCGGTATG CTCTCTAAAA ATCAACAAAT TATTTTGAAC CAGTTCATCT CAAGCATATT GGAGACTTGG
AGTACATCCA TTTAATATTC ATCTTTGATG TAATACAGAA GGGATACCCT TCCGACTCTG CAGCATATGG AGACCCGAAT
CTTATTGCTC ATAAGCTTCC AGTTGTGATG CAGAAGATCC AAAAGCTGAA ATTACCCAAT TAACCCGACA ACCCATCTCG
TGTACATCAG CGTTTTTTTT TTCCATTGAC TGTTGGACGG TGTTCTCTTT CTGCTTATCA TGTGCTGTGG TCTGTGGATG
CACGTTCCTG TAGCTGGCAA TAGTATAAAA ATTCTTGTGG TAAAGGCTAT TTGTCTACTG GGGCTTATCA GCTTTT

Locus: Os03g0760600

Loading...

Locus: Os03g0760600

Loading...