Os03t0762000-02

Locus

Os03g0762000

Description

Casein kinase II alpha subunit, Heading date, Photoperiod sensitivity

RAP-DB Gene Symbol Synonym(s)

HD6, Hd6, Hd6(t)*, OsCKA2, OSCKA2

RAP-DB Gene Name Synonym(s)

HEADING DATE 6, Heading date 6, Heading date (QTL)-6(t), Heading date-6, casein kinase II alpha subunit

CGSNL Gene Symbol

HD6

CGSNL Gene Name

HEADING DATE 6

Oryzabase Gene Symbol Synonym(s)

Hd6(t)*, OSCKA2, OsCKA2, CKA2, OsCKA2-1, CKA2-1, Hd6/CK2alpha, CK2alpha

Oryzabase Gene Name Synonym(s)

Heading date (QTL)-6(t), Heading date-6, Heading date6, casein kinase II alpha subunit, CK2alpha subunit 1, Casein Kinase 2alpha

Transcript Evidence

AB036785 (DDBJ)

AB036787 (DDBJ)

Protein Evidence

Q9AQU1 (UniProt)

Literature

PMID: 11743085

PMID: 17406851

PMID: 11416158

PMID: 20007447

Note

Manual Curation

August 2, 2009

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Expression Databases

TENOR (Os03t0762000-02)

Others

Oryzabase (529)

Transcript

1474 bp

>Os03t0762000-02 Casein kinase II alpha subunit, Heading date, Photoperiod sensitivity
CGTCCCACGCCGCCTCTATCTATCTCCACGTGAAATAAAAAAAAAACAAAGCTCCCGAAA
ATATTCTCTCTCCCCCACCCCCGAAACCCTAGCGCGACCTCGCCGCCGGCAATGGCCGCA
TGACCGATGCGCCTCCGCCGAGGAGCCGCCCGCACCCACCCAGCAGCAGCGTCGCCGTGC
CCGCCGCCGCGGCGGCAGTGATCGCAGCCGCCCTCGCGTCCTCCTTCCTCGCCCTGCTGC
AGCCGCCCCGGCGCGCCCCGGTCGCCGCGGGATCCAGGGTCGGCATGTCGAAGGCGAGGG
TCTACGCCGACGTCAACGTGCTGCGCCCCAAGGAGTACTGGGACTACGAGGCGCTCACCG
TTCAATGGGGTGAGCAGGATGACTATGAAGTTGTCAGGAAAGTTGGAAGAGGTAAATATA
GTGAAGTCTTTGAAGGCATCAATGTTAACAACAATGAGAAATGCATCATCAAGATACTCA
AGCCTGTGAAGAAAAAGAAGATCAAAAGGGAGATTAAAATACTTCAGAATCTTTGTGGAG
GTCCAAACATTGTGTAGCTTCTTGATATTGTCAGAGATCAACATTCTAAGACTCCTAGCT
TGATCTTTGAATATGTCAACAATACAGACTTCAAAGTGCTGTACCCCACGTTGACAGATT
ATGATATCCGCTACTACATATATGAGCTACTCAAGGCATTAGACTACTGCCATTCACAAG
GCATTATGCATCGAGATGTCAAGCCCCACAATGTTATGATAGATCATGAGCTCCGAAAAC
TTCGATTGATAGACTGGGGCCTGGCTGAGTTCTATCATCCAGGGAAGGAATATAATGTTC
GTGTTGCTTCAAGGTATTTCAAGGGGCCTGAGCTTCTTGTTGATTTGCAAGATTATGATT
ATTCTTTGGACATGTGGAGCCTTGGTTGCATGTTTGCTGGGATGATATTCCGCAAGGAGC
CATTCTTCTATGGTCATGATAACCATGATCAACTTGTCAAGATCGCAAAGGTACTTGGAA
CAGAAGCACTAAATGCTTATTTGAACAAGTACCATATTGAGCTTGATCCTCAGCTTGAAG
CTCTTGTTGGGAGGCATAGTAGAAAACCATGGTCGAAATTCATTAATGCTGATAACCAAC
ATCTAGTATCTCCTGAGGCTGTAGATTTTCTTGATAAGCTTCTACGTTATGATCACCAAG
ATAGGCTCACTGCACGTGAAGCTATGGCACATCCGTACTTCCTCCAAGTGAGAGCTGCAG
AAAATAGCAGAGCACGACCACAATGATCTTGTGTACCTGCTAAAATGATGATCCAGCTGA
TGATCCACGACGGTACTACTTTGAGTTTGTGTGAACGATCGTGGAATGTGCTTGTAGCCT
TGCATTTGTAAACTGTAATTCACTCCGTTGGTTGCGTTTGATGAATGCCGTGACATGCAC
ATAATTATTTATTTCTGTAATGTTTTACCATAAC

CDS

273 bp

>Os03t0762000-02 Casein kinase II alpha subunit, Heading date, Photoperiod sensitivity
ATGTCGAAGGCGAGGGTCTACGCCGACGTCAACGTGCTGCGCCCCAAGGAGTACTGGGAC
TACGAGGCGCTCACCGTTCAATGGGGTGAGCAGGATGACTATGAAGTTGTCAGGAAAGTT
GGAAGAGGTAAATATAGTGAAGTCTTTGAAGGCATCAATGTTAACAACAATGAGAAATGC
ATCATCAAGATACTCAAGCCTGTGAAGAAAAAGAAGATCAAAAGGGAGATTAAAATACTT
CAGAATCTTTGTGGAGGTCCAAACATTGTGTAG

Protein

91 aa

>Os03t0762000-02 Casein kinase II alpha subunit, Heading date, Photoperiod sensitivity
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKC
IIKILKPVKKKKIKREIKILQNLCGGPNIV*

5'UTR

chr03:31514177..31514460 (- strand) : 284 bp

CDS

chr03:31514091..31514176 (- strand) : 86 bp

chr03:31512595..31512724 (- strand) : 130 bp

chr03:31512458..31512514 (- strand) : 57 bp

3'UTR

chr03:31512320..31512457 (- strand) : 138 bp

chr03:31511496..31511653 (- strand) : 158 bp

chr03:31510832..31510922 (- strand) : 91 bp

chr03:31510649..31510714 (- strand) : 66 bp

chr03:31510004..31510086 (- strand) : 83 bp

chr03:31509864..31509927 (- strand) : 64 bp

chr03:31509718..31509786 (- strand) : 69 bp

chr03:31508813..31509060 (- strand) : 248 bp

FASTA

>Os03t0762000-02 class=Sequence position=chr03:31508813..31514460 (- strand)
CGTCCCACGC CGCCTCTATC TATCTCCACG TGAAATAAAA AAAAAACAAA GCTCCCGAAA ATATTCTCTC TCCCCCACCC
CCGAAACCCT AGCGCGACCT CGCCGCCGGC AATGGCCGCA TGACCGATGC GCCTCCGCCG AGGAGCCGCC CGCACCCACC
CAGCAGCAGC GTCGCCGTGC CCGCCGCCGC GGCGGCAGTG ATCGCAGCCG CCCTCGCGTC CTCCTTCCTC GCCCTGCTGC
AGCCGCCCCG GCGCGCCCCG GTCGCCGCGG GATCCAGGGT CGGCATGTCG AAGGCGAGGG TCTACGCCGA CGTCAACGTG
CTGCGCCCCA AGGAGTACTG GGACTACGAG GCGCTCACCG TTCAATGGGG GTAGGTAGCA CAGCCAGCCA GCTGACGTCA
CCTTCCTGAG CCCCCTGATC AGCGGCCGTA GCTTGTATTC TCCAGATTTA GTTCGCGATC CGTATCCCGT ACACCTGGGC
TGGGTTTGCT TATTGGGATT AGGTTGGATT ATTGGGTTAT GCGTAGGTTT GCTTGTGCCT GTAGATTTTG GTTTTGGTCA
GGGAATTGGG AATTTATTGT AGCTTGAAGG TTAGATTGAA TTGCTTCTGT TTCTATTAGG ACGAACTCAA TACCGAAGAC
TGCTTTGGTA GTTTTACATG TTTGTACTAT AGGAGTAGGG GACACATGTT TACCGAATGG TTGAAGAAAT TGTTATGAAT
TTGCAAGGTT ATGATTTTAA TTTTGGAATC AATCTCACTA TATCTTCCTT TTAAAGTTGA TACTAGTGTT GTTCAGTTAA
GAGCCTTTGT TTGATTGTGA ATGGCAAGCT GTAGGTATTG ATCCTATTTT TGTTGGGGAT AAAATCTAAG TTAAGGCAAA
ATTAGGCAGT TTTATGTTTA ATCATTGGAA CAAAGTAAGT TGGTGATGGG TTTCTGGGTG TTTCTTTTGC ATCATCTGAT
AACCAAGATT GATGAGTAAA GCATAACTTG GTAGTATAGT GCTTTGGGCC TAATCTTCTT TAGCACTGAA CATTCACCAA
GTTCTATGCT TTTATGTAAT CTCAAATTTA ACATTGTGTT TTCCTTCACT CACCCTAGAA TATACTACCT GAAAGCAATC
AATGAAATCA AATATAACTT CGTTTCTACC TATATGATTG TAACATGCTG AGTAATATGG TGCCAAACAA CTCAACACAT
ATAATACTGT CCTTAACAAC CCATCTTCTT TTCCCTGTAG AAGTTACAGC CCTAGTATAT TCTGTACATG TCATGCTACC
TAGATGACAG TTGAGGCCTG GTAGGAGTGT GCTTGTTTAA TTTTGGTACT CCAAAAGTGC ACTGTTTTTC TCAATCTGAC
TCTGTTACCA GTTGTGTTTC CTCTAGATGT ATTCCTTATC TATGGTGAAT TATTAAATAA GTTGTCTGGT GACAAAAAAA
AAAGAAAAAT AAAAGAAGAG ATGAACAATA TGTAGCTCAT TGATGATCCC TTGTCTGCTT GAACTTTATG AGAAACTATA
GAAAGCAGTG GTGTTTTCCC TGACCTGATG TTAAATACTT GTTAAGAATT GAGCTTTCTT CGAAGTTTGT TCAGTTTACA
CACCAACACT AAGAATTGCC ATATATCTCC CATCTTTTGT CCATTTAATT CTTGTTACCT CAAGTCATTG AGGGACCTGG
CAGCATGTTA TGACTTACAC AATACCTCGC TAACTATTAT GGTGCATCTT TAACAGTGAG CAGGATGACT ATGAAGTTGT
CAGGAAAGTT GGAAGAGGTA AATATAGTGA AGTCTTTGAA GGCATCAATG TTAACAACAA TGAGAAATGC ATCATCAAGA
TACTCAAGCC TGTGAAGAAA AAGAAGGTAT TTAATTGATC TTATTGACTG TTTTTTTTAA TTGCTAGTGT TGAAGTTCTT
AACCTACCTT TCATATGTTT GAACAGATCA AAAGGGAGAT TAAAATACTT CAGAATCTTT GTGGAGGTCC AAACATTGTG
TAGCTTCTTG ATATTGTCAG AGATCAACAT TCTAAGACTC CTAGCTTGAT CTTTGAATAT GTCAACAATA CAGACTTCAA
AGTGCTGTAC CCCACGTTGA CAGATTATGA TATCCGCTAC TACATATATG AGCTACTCAA GGTCTTCATT GAGCCTTCAT
TGTCATCCCT ATTTATTTAC TCTATTCAGT AAAACATCCT GTTCTGTGGA TCTGTAGAAT GATGTATCTC TTATAGAAAT
TGTTTCACAA TTACTTTCCT ATTATGTGAA GATCCAACTA AACACACTTG TAATATATCC TAGACAAATA TCACCATTCT
CACTGCTTGC AAGTTGCAAC ATATCTTTAA TTATTTATGT ATATATGAAC TTGATTATTT TCTAAGTTAC ATGGCTTAAA
ACTTGTCACA ATCTCAAGCA GTTTATGGAT CAGTTTTGTT TTGAGTTTTA ATTATAGTAG CATCTTGCAC TTCATAATGT
ACAGATGACA AAAGAATTCC TGAATTGCAT ATGTGCTATA ATGGTTTATG ATCTGGGATT TTGAAGAGAA GTGTCGTTTT
ATACATTTCT AAGTTCAGCA CTATGTTGGT GTTAAGAATT CAGCCATCAA TGGGCATCTT AACGTATGTG CTAGGTCATG
CCTTCTATCC ATGGGTAATA AACTGTTAAC ACACAGTGTG TGTTTTTCAT ATCGATATTC TTAGCCAAGA ACAGTAGCAT
CATTTGCCCT TAATCCTGTG TGTTAAGTTT GTTTAAAGAA TCTAGTTGAT TTTCTTTACA ATATTTTCCT TCTGTTTATG
GCCCCAGGCA TTAGACTACT GCCATTCACA AGGCATTATG CATCGAGATG TCAAGCCCCA CAATGTTATG ATAGATCATG
AGCTCCGAAA ACTTCGATTG ATAGACTGGG GCCTGGCTGA GTTCTATCAT CCAGGGAAGG AATATAATGT TCGTGTTGCT
TCAAGGTTGG TGTAGTTACA AGCAAACTAC TTGTTTGGTT ATGATTTTCT TGCTTTTTTA TTGAATTGGA TTGCACCCTG
ATAATCACTT GAATCATGAG AGGAAGCTAA CTTAAGAAGG TAGCATCCCT GTTTTGCAGT TTGTTTGCTA ACTTGGCTCT
AGAAGCAATA CGTGAACCGA TAAATTACTT GGTTTGAATT CACTGCTACT GTTGAAGTCT GAATTGCCTA GTGGTCCTTT
TGCAACATTA ATGTTACGAA ATGCTGAAAG TTAAGCAATG AAGCTGTTTA CCCTTAAACA ACTAAGTTTA CGTCTGAAAA
AAAGGCAATA AAACAGATAC CATTACTAGC CCTTTATTAT TTTTGTAAGC ATGTTATCAC TGGAGTATAT CATGCAATTA
TTGGGTGTAC GTCTGAAAAA AGGCAATAAA ACAGATACCA TTACTAGGAC TTTATTATTT TTGTAAGCAT GTTATCACTG
GAATAGATCA TGCAATTATT GCTTACTAAT GCGTCAATTC TTTGCTCATT TTTGCTTTGG TACCTGAGTT GAGCATATGG
TTTCTCGTTT TTATTCAGGT ATTTCAAGGG GCCTGAGCTT CTTGTTGATT TGCAAGATTA TGATTATTCT TTGGACATGT
GGAGCCTTGG TTGCATGTTT GCTGGGATGG TATGTGTGGC TGTAAAAAAT ATCGCCTGTC TAGGTCAATG TCTGGATATC
TAATGTACTA TTGTATTGAT AATAAGTCTG ACGTCTGAAC TCAGTTAACT GTATGCTATG ATGCAGATAT TCCGCAAGGA
GCCATTCTTC TATGGTCATG ATAACCATGA TCAACTTGTC AAGATCGCAA AGGTAAGTCC CAGTTTGATT CTGGCCTCTC
ACATTTCTCA AGGGAAAAAA AATGGTTTGG TATGCCTGAT AAAATGTTTA GTTATGCAAC TCGTGTTTTG GACTGGTTGG
TATACATGTT TTACTTTGTT TCTAAAAAAA ATTGCTGTTT GTGCTCCTTT TAGCTTAGTA CTCATATGTT ATTCTGACAT
ATAAGCAGTG TGATGTCGTC AAAATAAATT ATGTTCATTT GTAAATTGTG ATTTTTGAAG TTCTTATTTG TTGCTCTCGA
ACTCTTACTA GGACGGTTAT TGGCATTTAA AGATGTTTTA AGCATCCAAT AATGCCTCGA GTGTGTGTCA GCAGTGTTGA
TTCGCTTGTC ATCAGTTGAA AACTAAGTAC TTTTCCAGCA TTATGCTATT GATATCGGAC TAAGGCAGAT GTCATAATGT
ACTTTGATAT CTATGCAAAT TTTATTCTTG ATCTGTTTTA GTGGTTTATA TAAGTGCTTA TTTTGGAATA ACAATAAAAC
AGCTATATGT GAAATATTGG TATCTGATCC ATGTGTTTTC CCCATCATTC TCAGGTACTT GGAACAGAAG CACTAAATGC
TTATTTGAAC AAGTACCATA TTGAGCTTGA TCCTCAGCTT GAAGCTCTTG TTGGGAGGTA CGTTGCCATG CTTTTAGATA
TTGGTTTTGA ACGGGAAGAT TCAGAAGTAT AACACTTACA TATACATATG CAGGCATAGT AGAAAACCAT GGTCGAAATT
CATTAATGCT GATAACCAAC ATCTAGTATC TCCTGAGGTT TGTCAATGGC TCTTGCTGTT TCCAAATCAA CCTTAAGATA
ATGTTTGCTT AACATCATGC TTGTACATTT GTAGGCTGTA GATTTTCTTG ATAAGCTTCT ACGTTATGAT CACCAAGATA
GGCTCACTGC ACGTGAAGCT ATGGTAAGTC TACCCCGACA GATAATATTT GTTACATTCC AAGAAGATAC TGATTTTGTT
TGACTGGATA TTTCCTATTT ATGTAACAGT ATTGACTGTT CACTGAGATT GTTAGTTTAT TGCTGAATAT TTTAGTATAT
ATCCTCCTTT TTAGTCATAA GAATTACATC AATGATGTCA TAATAGTACT TTCATCTTCC TATCCTATCA CACCTCTGTT
CAATTTTTAT TTTAGGCATA TTCTGTTTCA CTTATTGCTC TGTATTATGA CAATATCATA AAACATTTTC CTGACCCTCA
ACCAAAAATA GTTGGCAAGT TATGCATTTG TATAGGTACA CTTCAACTAG GGATGCAAGT GGAGCGGGCA ATCGGTTATT
TTTTGCCTGT TTATCTCAAT TCTAGTTCAA TTGTTGTAGG TATTTATGCA GGTAACAGGA TTGCTTACTC GCATCGCTAA
CTTCAACCCA ATATAATTTG GCAAATGGTG CATTTGGCAA TAGATAGAAA CCCTTCAAAT TTCTCTGCCA CATTGGCTTT
TGTATGCAAT GAACAACGTT TCATCTTCAC ATAGTATCTG GCCAGTTGTA GGAGGAACAA ATTGTTATTT GATTACTCTT
GGACTTCTCA AATTAATGCC ATAATCATGA ATACTTGCAG GCACATCCGT ACTTCCTCCA AGTGAGAGCT GCAGAAAATA
GCAGAGCACG ACCACAATGA TCTTGTGTAC CTGCTAAAAT GATGATCCAG CTGATGATCC ACGACGGTAC TACTTTGAGT
TTGTGTGAAC GATCGTGGAA TGTGCTTGTA GCCTTGCATT TGTAAACTGT AATTCACTCC GTTGGTTGCG TTTGATGAAT
GCCGTGACAT GCACATAATT ATTTATTTCT GTAATGTTTT ACCATAAC