Os03t0758500-01

Locus

Os03g0758500

Description

Cupredoxin domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ENODL12

CGSNL Gene Name

EARLY NODULIN LIKE PROTEIN 12

Oryzabase Gene Symbol Synonym(s)

OsENODL12

Oryzabase Gene Name Synonym(s)

early nodulin-like protein 12

Transcript Evidence

AK102002 (DDBJ, Best hit)

Protein Evidence

NP_001150509.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: copper ion binding (GO:0005507)

Molecular Function: electron carrier activity (GO:0009055)

Functional domain (InterPro)

Plastocyanin-like (IPR003245)

Cupredoxin (IPR008972)

Full-length cDNA

J033079N03 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0758500-01)

RiceXPro (AK102002)

Others

Oryzabase (9737)

KEGG (Os03t0758500-01)

Transcript

756 bp

>Os03t0758500-01 Cupredoxin domain containing protein.
GAGAGCTTCCCCCCGCCACGCCGGCCACCTCACCACTCTCGTTTCGTTTCAGGCGGCGAG
AGCGGGAGAGCAAGCGAATTCTCTCAGCTCGATTTGTGTTTTTTTTTTGAGGGGGAGGAG
GTGAGTGCAACGGCGATGGTGATGACGAGGAGGAGGGCGGCGCTGCTGGTGGTGGCGATG
TGCGCGTGCGCGGCGCTGCCGTCGACCACGACGGCGAACAAGTTCTCCATCAACTGGAAG
CCCAACACCAACTACTCCGACTGGCCCGCCCAGCACGGCCCCTTCTACAAGGGCGACTGG
CTCGTGTTCTACTACACGGCGGGGCAGGCGGACGTGATCCAGGTGGACGCGGCGGGGTAC
AATACGTGCGACGCCACCAACGCCATCTCCAACTACAGCAAGGGCCGCACCTACGCCTTC
GAGCTCAACGAGACCAAGACCTACTACTTCATCTGCAGCTACGGCTACTGCTTCGGCGGC
ATGCGCCTCCAAATCAAGACCGAGAAGCTCCCGCCACCGTCCCCGCCGGCCGCCGCCAAG
GACAAGTCCGCCGCCGCATTCACCGCCTCGCGCGCCTCGCTCTTCTACGCCGCCGCCGCC
GCCGTGCTCGCCGCGATTCTCAGGATGTTTTAGCTGCTAGTAGTAGTAGCGTTGTCTGCT
GTCTTCGTCTGATTTGGAGGTCCTCCCCTGATTTTTTTAGTGTGTTTGGAACCCTGGAAA
TTTTAGTAGAACCTCGATTATTAGTGTGGATTTGCG

CDS

498 bp

>Os03t0758500-01 Cupredoxin domain containing protein.
ATGGTGATGACGAGGAGGAGGGCGGCGCTGCTGGTGGTGGCGATGTGCGCGTGCGCGGCG
CTGCCGTCGACCACGACGGCGAACAAGTTCTCCATCAACTGGAAGCCCAACACCAACTAC
TCCGACTGGCCCGCCCAGCACGGCCCCTTCTACAAGGGCGACTGGCTCGTGTTCTACTAC
ACGGCGGGGCAGGCGGACGTGATCCAGGTGGACGCGGCGGGGTACAATACGTGCGACGCC
ACCAACGCCATCTCCAACTACAGCAAGGGCCGCACCTACGCCTTCGAGCTCAACGAGACC
AAGACCTACTACTTCATCTGCAGCTACGGCTACTGCTTCGGCGGCATGCGCCTCCAAATC
AAGACCGAGAAGCTCCCGCCACCGTCCCCGCCGGCCGCCGCCAAGGACAAGTCCGCCGCC
GCATTCACCGCCTCGCGCGCCTCGCTCTTCTACGCCGCCGCCGCCGCCGTGCTCGCCGCG
ATTCTCAGGATGTTTTAG

Protein

166 aa

>Os03t0758500-01 Cupredoxin domain containing protein.
MVMTRRRAALLVVAMCACAALPSTTTANKFSINWKPNTNYSDWPAQHGPFYKGDWLVFYY
TAGQADVIQVDAAGYNTCDATNAISNYSKGRTYAFELNETKTYYFICSYGYCFGGMRLQI
KTEKLPPPSPPAAAKDKSAAAFTASRASLFYAAAAAVLAAILRMF*

5'UTR

chr03:31360334..31360468 (- strand) : 135 bp

CDS

chr03:31360165..31360333 (- strand) : 169 bp

chr03:31359701..31360029 (- strand) : 329 bp

3'UTR

chr03:31359578..31359700 (- strand) : 123 bp

FASTA

>Os03t0758500-01 class=Sequence position=chr03:31359578..31360468 (- strand)
GAGAGCTTCC CCCCGCCACG CCGGCCACCT CACCACTCTC GTTTCGTTTC AGGCGGCGAG AGCGGGAGAG CAAGCGAATT
CTCTCAGCTC GATTTGTGTT TTTTTTTTGA GGGGGAGGAG GTGAGTGCAA CGGCGATGGT GATGACGAGG AGGAGGGCGG
CGCTGCTGGT GGTGGCGATG TGCGCGTGCG CGGCGCTGCC GTCGACCACG ACGGCGAACA AGTTCTCCAT CAACTGGAAG
CCCAACACCA ACTACTCCGA CTGGCCCGCC CAGCACGGCC CCTTCTACAA GGGCGACTGG CTCGGTACTC TCCCCTCTCC
CCCTCCTCCT CCTCCTGCTT CACCCGCCTC TCGTGTGCCC AGATCTGGCA GATGAAACGC TTGATTTCTC ATTTGGTTTG
ATTTTGATTC TTCTCATCTC TGATTTGGGA TGTGGGCAGT GTTCTACTAC ACGGCGGGGC AGGCGGACGT GATCCAGGTG
GACGCGGCGG GGTACAATAC GTGCGACGCC ACCAACGCCA TCTCCAACTA CAGCAAGGGC CGCACCTACG CCTTCGAGCT
CAACGAGACC AAGACCTACT ACTTCATCTG CAGCTACGGC TACTGCTTCG GCGGCATGCG CCTCCAAATC AAGACCGAGA
AGCTCCCGCC ACCGTCCCCG CCGGCCGCCG CCAAGGACAA GTCCGCCGCC GCATTCACCG CCTCGCGCGC CTCGCTCTTC
TACGCCGCCG CCGCCGCCGT GCTCGCCGCG ATTCTCAGGA TGTTTTAGCT GCTAGTAGTA GTAGCGTTGT CTGCTGTCTT
CGTCTGATTT GGAGGTCCTC CCCTGATTTT TTTAGTGTGT TTGGAACCCT GGAAATTTTA GTAGAACCTC GATTATTAGT
GTGGATTTGC G

Locus: Os03g0758500

Loading...

Locus: Os03g0758500

Loading...